Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ANT(2")-IA IN COMPLEX WITH ADENYLYL-2"-TOBRAMYCIN
 
Authors :  D. Rodionov, A. V. Bassenden, A. M. Berghuis
Date :  08 Jul 15  (Deposition) - 20 Jul 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.82
Chains :  Asym./Biol. Unit :  A
Keywords :  Antibiotic Resistance, Nucleotidyltransferase, Ampcpp, Tobramycin, Modified Aminoglycoside, Rossmann Fold, Transferase-Antibiotic Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Rodionov, A. V. Bassenden, A. M. Berghuis
Crystal Structure Of Ant(2")-Ia In Complex With Adenylyl-2"-Tobramycin
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - AMINOGLYCOSIDE NUCLEOTIDYLTRANSFERASE (2")-IA
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-22B(+)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: AADB, TNCP6
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287
    Synonym: AADB

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric/Biological Unit (4, 8)
No.NameCountTypeFull Name
151H1Ligand/IonADENYLYL-2"-TOBRAMYCIN
2BU13Ligand/Ion1,4-BUTANEDIOL
3MN2Ligand/IonMANGANESE (II) ION
4POP2Ligand/IonPYROPHOSPHATE 2-

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:44 , ASP A:46 , 51H A:203 , POP A:204 , HOH A:350binding site for residue MN A 201
2AC2SOFTWARE51H A:203 , POP A:204 , POP A:205 , HOH A:369 , HOH A:389binding site for residue MN A 202
3AC3SOFTWAREASP A:44 , ASP A:46 , TYR A:74 , ASP A:86 , GLU A:88 , ILE A:99 , ALA A:100 , ASP A:131 , TYR A:132 , TYR A:134 , TYR A:135 , GLU A:138 , HIS A:148 , MN A:201 , MN A:202 , POP A:204 , POP A:205 , HOH A:306 , HOH A:307 , HOH A:312 , HOH A:314 , HOH A:331 , HOH A:337 , HOH A:362 , HOH A:365 , HOH A:368 , HOH A:369 , HOH A:384 , HOH A:389 , HOH A:396binding site for residue 51H A 203
4AC4SOFTWAREGLY A:28 , ARG A:40 , HIS A:42 , ASP A:43 , ASP A:44 , ASP A:46 , LYS A:147 , HIS A:148 , MN A:201 , MN A:202 , 51H A:203 , POP A:205 , HOH A:311 , HOH A:314 , HOH A:350 , HOH A:369binding site for residue POP A 204
5AC5SOFTWAREASP A:43 , LYS A:147 , MN A:202 , 51H A:203 , POP A:204 , HOH A:369 , HOH A:389 , HOH A:425binding site for residue POP A 205
6AC6SOFTWAREGLU A:126 , LYS A:163 , HOH A:304 , HOH A:343binding site for residue BU1 A 206
7AC7SOFTWARETRP A:92 , HOH A:378binding site for residue BU1 A 207
8AC8SOFTWARETRP A:24 , ALA A:96 , TYR A:97 , CYS A:107 , GLU A:109binding site for residue BU1 A 208

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CFU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CFU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CFU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CFU)

(-) Exons   (0, 0)

(no "Exon" information available for 5CFU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:174
                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh....eehhhhhhhhhhh........eeeeee..hhhhhhhhhhhh..eeeee....eeeee..eeeeeeeeee....ee..............eee..eee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cfu A   3 TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA 176
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CFU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CFU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CFU)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5CFU)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    51H  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BU1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    POP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5cfu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cfu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6X3H6_PSEAI | Q6X3H6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6X3H6_PSEAI | Q6X3H6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6X3H6_PSEAI | Q6X3H6: 4xje 5cfs 5cft

(-) Related Entries Specified in the PDB File

4xje 4XJE CONTAINS THE SAME PROTEIN IN COMPLEX WITH TOBRAMYCIN AND AMP
5cfs
5cft