Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE MURINE CD44 HYALURONAN BINDING DOMAIN COMPLEX WITH A SMALL MOLECULE
 
Authors :  L. K. Liu, B. C. Finzel
Date :  11 Jun 15  (Deposition) - 29 Jun 16  (Release) - 29 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.31
Chains :  Asym./Biol. Unit :  A
Keywords :  Link Module, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. K. Liu, B. C. Finzel
Crystal Structure Of The Murine Cd44 Hyaluronan Binding Domain Complex With A Small Molecule
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CD44 ANTIGEN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentHYALURONAN BINDING DOMAIN, RESIDUES 21-171
    GeneCD44, LY-24
    MutationYES
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymEXTRACELLULAR MATRIX RECEPTOR III,ECMR-III,GP90 LYMPHOCYTE HOMING/ADHESION RECEPTOR,HUTCH-I,HERMES ANTIGEN,HYALURONATE RECEPTOR, LYMPHOCYTE ANTIGEN 24,LY-24,PHAGOCYTIC GLYCOPROTEIN 1,PGP-1, PHAGOCYTIC GLYCOPROTEIN I,PGP-I

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric/Biological Unit (4, 4)
No.NameCountTypeFull Name
168N1Ligand/Ion[(1S)-1,2,3,4-TETRAHYDROISOQUINOLIN-1-YL]METHANOL
26BT1Ligand/Ion[(1R)-1,2,3,4-TETRAHYDROISOQUINOLIN-1-YL]METHANOL
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4SO41Ligand/IonSULFATE ION

(-) Sites  (25, 25)

Asymmetric Unit (25, 25)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:32 , ASN A:89 , CYS A:134 , THR A:135 , SER A:136 , ARG A:155 , ASP A:156 , HOH A:311 , HOH A:313binding site for residue DMS A 201
02AC2SOFTWAREARG A:33 , PHE A:38 , PHE A:60 , ASN A:125binding site for residue SO4 A 202
03AC3SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
04AC4SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
05AC5SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
06AC6SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
07AC7SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
08AC8SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
09AC9SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
10AD1SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
11AD2SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
12AD3SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
13AD4SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
14AD5SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
15AD6SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
16AD7SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
17AD8SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
18AD9SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
19AE1SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
20AE2SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
21AE3SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
22AE4SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
23AE5SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
24AE6SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204
25AE7SOFTWAREASN A:29 , VAL A:30 , HIS A:39 , GLU A:41 , ASP A:68 , VAL A:153 , ASN A:154 , ARG A:155 , HOH A:376 , HOH A:380 , HOH A:389binding site for residues 68N A 203 and 6BT A 204

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:32 -A:134
2A:57 -A:123
3A:81 -A:101

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5BZE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5BZE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5BZE)

(-) Exons   (0, 0)

(no "Exon" information available for 5BZE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:150
                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..ee..eeeeee......hhhhhhhhhhhh.....hhhhhhhhhhh.......ee....eeeee......hhhhh.eeee.........eeeee.......ee..........eeeeeeeeeee....eeeeeee...hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5bze A  24 NQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI 173
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5BZE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5BZE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5BZE)

(-) Gene Ontology  (41, 41)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    68N  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    6BT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5bze)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5bze
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CD44_MOUSE | P15379
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CD44_MOUSE | P15379
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CD44_MOUSE | P153792jcp 2jcq 2jcr 2zpy 4mrd 4mre 4mrf 4mrg 4mrh 4np2 4np3 5bzc 5bzf 5bzg 5bzh 5bzi 5bzj 5bzk 5bzl 5bzm 5bzn 5bzo 5bzp 5bzq 5bzr 5bzs 5bzt

(-) Related Entries Specified in the PDB File

5bzc 5bzf 5bzg 5bzh 5bzi 5bzj 5bzm 5bzn 5bzo 5bzp 5bzq 5bzr 5bzs 5bzt