Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI SPERMIDINE SYNTHASE IN COMPLEX WITH 2-(2-FLUOROPHENYL)ETHANAMINE
 
Authors :  Y. Amano, Y. Tateishi
Date :  17 Dec 15  (Deposition) - 21 Dec 16  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.58
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Polyamine Synthesis, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Yoshino, N. Yasuo, Y. Hagiwara, T. Ishida, D. K. Inaoka, Y. Amano, Y. Tateishi, K. Ohno, I. Namatame, T. Niimi, M. Orita, K. Kita, Y. Akiyama, M. Sekijima
In Silico, In Vitro, X-Ray Crystallography, And Integrated Strategies For Discovery Of Spermidine Synthase Inhibitor For An Anti-Trypanosomiasis Drug
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SPERMIDINE SYNTHASE, PUTATIVE
    ChainsA, B, C, D
    EC Number2.5.1.16
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTC00.1047053510339.50
    Organism ScientificTRYPANOSOMA CRUZI STRAIN CL BRENER
    Organism Taxid353153
    StrainCL BRENER

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1BSX4Ligand/Ion2-(2-FLUOROPHENYL)ETHANAMINE
2S4M4Ligand/Ion5'-[(S)-(3-AMINOPROPYL)(METHYL)-LAMBDA~4~-SULFANYL]-5'-DEOXYADENOSINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1BSX2Ligand/Ion2-(2-FLUOROPHENYL)ETHANAMINE
2S4M2Ligand/Ion5'-[(S)-(3-AMINOPROPYL)(METHYL)-LAMBDA~4~-SULFANYL]-5'-DEOXYADENOSINE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1BSX2Ligand/Ion2-(2-FLUOROPHENYL)ETHANAMINE
2S4M2Ligand/Ion5'-[(S)-(3-AMINOPROPYL)(METHYL)-LAMBDA~4~-SULFANYL]-5'-DEOXYADENOSINE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:40 , LEU A:59 , GLN A:64 , HIS A:74 , GLY A:95 , ASP A:98 , ASP A:118 , ILE A:119 , ASP A:120 , VAL A:123 , ASP A:149 , GLY A:150 , ASP A:168 , THR A:169 , THR A:170 , PRO A:175 , ALA A:176 , LEU A:179 , TYR A:237 , BSX A:502binding site for residue S4M A 501
2AC2SOFTWARETRP A:19 , GLN A:64 , TYR A:73 , THR A:169 , THR A:170 , ASP A:171 , GLN A:201 , TYR A:237 , PRO A:238 , S4M A:501 , HOH A:618 , HOH A:626 , HOH A:689binding site for residue BSX A 502
3AC3SOFTWAREGLN B:40 , MET B:57 , LEU B:59 , GLN B:64 , TYR B:73 , HIS B:74 , GLY B:95 , ASP B:98 , VAL B:117 , ASP B:118 , ILE B:119 , ASP B:120 , VAL B:123 , ASP B:149 , GLY B:150 , ASP B:168 , THR B:169 , THR B:170 , PRO B:175 , ALA B:176 , LEU B:179 , TYR B:237 , BSX B:502binding site for residue S4M B 501
4AC4SOFTWARETRP B:19 , GLN B:64 , TYR B:73 , THR B:169 , THR B:170 , ASP B:171 , GLN B:201 , TYR B:237 , PRO B:238 , S4M B:501 , HOH B:633 , HOH B:660 , HOH B:681binding site for residue BSX B 502
5AC5SOFTWAREGLN C:40 , LEU C:59 , GLN C:64 , HIS C:74 , GLY C:95 , ASP C:98 , ASP C:118 , ILE C:119 , ASP C:120 , VAL C:123 , ASP C:149 , GLY C:150 , ASP C:168 , THR C:169 , THR C:170 , PRO C:175 , ALA C:176 , LEU C:179 , TYR C:237 , BSX C:502 , HOH C:626binding site for residue S4M C 501
6AC6SOFTWARETRP C:19 , GLN C:64 , TYR C:73 , ASP C:168 , THR C:169 , THR C:170 , ASP C:171 , GLN C:201 , TYR C:237 , PRO C:238 , S4M C:501 , HOH C:619 , HOH C:625 , HOH C:679binding site for residue BSX C 502
7AC7SOFTWAREGLN D:40 , LEU D:59 , GLN D:64 , TYR D:73 , HIS D:74 , GLY D:95 , ASP D:98 , VAL D:117 , ASP D:118 , ILE D:119 , ASP D:120 , VAL D:123 , ASP D:149 , GLY D:150 , ASP D:168 , THR D:169 , THR D:170 , PRO D:175 , ALA D:176 , LEU D:179 , TYR D:237 , BSX D:502binding site for residue S4M D 501
8AC8SOFTWARETRP D:19 , GLN D:64 , TYR D:73 , THR D:169 , THR D:170 , ASP D:171 , GLN D:201 , TYR D:237 , PRO D:238 , S4M D:501 , HOH D:614 , HOH D:637 , HOH D:664binding site for residue BSX D 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5B1S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5B1S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5B1S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5B1S)

(-) Exons   (0, 0)

(no "Exon" information available for 5B1S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.ee..eee........eeeeeeeeeeeeeee....eeeeeee.......eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhh......eeeee.hhhhhhhhh....eeeeeee.......hhhhhhhhhhhhhhhheeeeeeeee.......hhhhhhhhhhhhhhhh..eeeeeeee...hhh.eeeeeeee............hhhhh.hhhhh...hhhhhhhhh..hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b1s A   1 MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN 294
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290    

Chain B from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.ee..eee........eeeeeeeeeeeeeee....eeeeeee.......eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh.....eeeeeee.......hhhhhhhhhhhhhhhheeeeeeeee.......hhhhhhhhhhhhhhhh..eeeeeeee...hhh.eeeeeeee............hhhhh.hhhhh...hhhhhhhh...hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b1s B   1 MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN 294
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290    

Chain C from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.ee..eee........eeeeeeeeeeeeeee....eeeeeee.......eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhh....eeeeeee.......hhhhhhhhhhhhhhhheeeeeeeee.......hhhhhhhhhhhhhhhh..eeeeeeee...hhh.eeeeeeee............hhhhh.hhhhh...hhhhhhhhh..hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b1s C   1 MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN 294
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290    

Chain D from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhh.ee..eee........eeeeeeeeeeeeeee....eeeeeee.......eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh.....eeeeeee.......hhhhhhhhhhhhhhhheeeeeeeee.......hhhhhhhhhhhhhhhh..eeeeeeee...hhh.eeeeeeee............hhhhh.hhhhh...hhhhhhhhh..hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b1s D   1 MPGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN 294
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5B1S)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5B1S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5B1S)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BSX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    S4M  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5b1s)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5b1s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4DA73_TRYCC | Q4DA73
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.16
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4DA73_TRYCC | Q4DA73
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4DA73_TRYCC | Q4DA733bwb 3bwc 4yuv 4yuw 4yux 4yuy 4yuz 4yv0 4yv1 4yv2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5B1S)