Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF METALLO-BETA-LACTAMASE SMB-1 BOUND TO HYDROLYZED MEROPENEM
 
Authors :  J. Wachino, Y. Arakawa
Date :  31 Jul 15  (Deposition) - 11 May 16  (Release) - 06 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.39
Chains :  Asym./Biol. Unit :  A
Keywords :  Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Wachino, Y. Arakawa
Crystal Structure Of Metallo-Beta-Lactamase Smb-1 Bound To Hydrolyzed Meropenem
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - METALLO-BETA-LACTAMASE
    Chains: A
    EC Number: 3.5.2.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 19-280
    Gene: SMB-1
    Organism Scientific: SERRATIA MARCESCENS
    Organism Taxid: 615

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 17)

Asymmetric/Biological Unit (5, 17)
No.NameCountTypeFull Name
1LMP1Ligand/Ion(2~{S},3~{R},4~{S})-2-[(2~{S},3~{R})-1,3-BIS(OXIDANYL)-1-OXIDANYLIDENE-BUTAN-2-YL]-4-[(3~{S},5~{S})-5-(DIMETHYLCARBAMOYL)PYRROLIDIN-3-YL]SULFANYL-3-METHYL-3,4-DIHYDRO-2~{H}-PYRROLE-5-CARBOXYLIC ACID
2NA10Ligand/IonSODIUM ION
3SO43Ligand/IonSULFATE ION
4TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
5ZN2Ligand/IonZINC ION

(-) Sites  (17, 17)

Asymmetric Unit (17, 17)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:72 , HIS A:74 , HIS A:150 , ZN A:302 , LMP A:317 , HOH A:459binding site for residue ZN A 301
02AC2SOFTWAREASP A:76 , HIS A:77 , HIS A:215 , ZN A:301 , LMP A:317 , HOH A:459binding site for residue ZN A 302
03AC3SOFTWAREPRO A:8 , GLN A:9 , VAL A:50 , ASN A:54 , PRO A:190 , HOH A:614 , HOH A:624binding site for residue NA A 303
04AC4SOFTWAREGLY A:24 , GLU A:217 , TRP A:222 , HOH A:411 , HOH A:698binding site for residue NA A 304
05AC5SOFTWAREILE A:245 , GLY A:249 , HOH A:474 , HOH A:620binding site for residue NA A 305
06AC6SOFTWAREHIS A:150 , THR A:177 , VAL A:179 , HOH A:465 , HOH A:547binding site for residue NA A 306
07AC7SOFTWARESER A:82 , GLN A:85 , ALA A:124 , HOH A:673binding site for residue NA A 307
08AC8SOFTWAREARG A:103 , LYS A:125 , VAL A:126 , SO4 A:314 , HOH A:517binding site for residue NA A 308
09AC9SOFTWARESER A:234 , VAL A:237 , HOH A:415 , HOH A:539 , HOH A:602 , HOH A:705binding site for residue NA A 309
10AD1SOFTWARESER A:70 , THR A:71 , ALA A:94 , GLY A:95 , GLY A:153 , ILE A:155 , HOH A:546binding site for residue NA A 310
11AD2SOFTWARESER A:73 , ASN A:98 , THR A:101 , PRO A:108 , HOH A:524binding site for residue NA A 311
12AD3SOFTWAREGLY A:16 , ASN A:17 , HIS A:19 , SER A:32 , HOH A:445 , HOH A:669 , HOH A:701binding site for residue NA A 312
13AD4SOFTWARELYS A:125 , ARG A:127 , THR A:177 , ARG A:252 , HOH A:432 , HOH A:433 , HOH A:474 , HOH A:534binding site for residue SO4 A 313
14AD5SOFTWAREALA A:124 , LYS A:125 , ARG A:127 , ARG A:252 , NA A:308 , HOH A:523 , HOH A:537binding site for residue SO4 A 314
15AD6SOFTWAREARG A:56 , LYS A:61 , LEU A:62 , SER A:63 , HOH A:522binding site for residue SO4 A 315
16AD7SOFTWARELYS A:66 , GLU A:217 , VAL A:218 , ASP A:220 , HOH A:426 , HOH A:433 , HOH A:440 , HOH A:662binding site for residue TRS A 316
17AD8SOFTWARETRP A:5 , ASP A:76 , HIS A:77 , GLN A:113 , LYS A:125 , HIS A:150 , SER A:175 , THR A:177 , HIS A:215 , GLU A:217 , ARG A:252 , ZN A:301 , ZN A:302 , HOH A:459 , HOH A:554 , HOH A:596binding site for residue LMP A 317

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:162 -A:167
2A:208 -A:242

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5AXO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5AXO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5AXO)

(-) Exons   (0, 0)

(no "Exon" information available for 5AXO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:259
                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee..eee........eee.....eeee.....hhhhhhhhhhhhh..hhh.eeeee....hhhhhhhhhhhhhhhh.eeeee..hhhhhhhh....................eeee....eeee..eeeeeee........eeeeeeeee..eeeeeeee...........hhhhhhhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5axo A   3 RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK 261
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5AXO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5AXO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5AXO)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5axo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5axo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G5ELM3_SERMA | G5ELM3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.5.2.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G5ELM3_SERMA | G5ELM3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G5ELM3_SERMA | G5ELM3: 3vpe 3vqz 5axr 5aya 5b15 5b1u

(-) Related Entries Specified in the PDB File

5awy