Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHA-E LECTIN IN COMPLEX WITH BISECTED GLYCAN
 
Authors :  M. Nagae, Y. Yamaguchi
Date :  12 Jun 15  (Deposition) - 27 Apr 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F,G,H  (1x)
Keywords :  Lectin, Glycan, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Nagae, M. Kanagawa, K. Morita-Matsumoto, S. Hanashima, Y. Kizuka, N. Taniguchi, Y. Yamaguchi
Atomic Visualization Of A Flipped-Back Conformation Of Bisected Glycans Bound To Specific Lectins
Sci Rep V. 6 22973 2016
PubMed-ID: 26971576  |  Reference-DOI: 10.1038/SREP22973

(-) Compounds

Molecule 1 - ERYTHROAGGLUTININ
    Chains: A, B, C, D, E, F, G, H
    Organism Common: KIDNEY BEAN
    Organism Scientific: PHASEOLUS VULGARIS
    Organism Taxid: 3885

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): ABCD    
Biological Unit 2 (1x):     EFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 80)

Asymmetric Unit (6, 80)
No.NameCountTypeFull Name
1BMA8Ligand/IonBETA-D-MANNOSE
2CA8Ligand/IonCALCIUM ION
3GAL8Ligand/IonBETA-D-GALACTOSE
4MAN16Ligand/IonALPHA-D-MANNOSE
5MN8Ligand/IonMANGANESE (II) ION
6NAG32Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (4, 32)
No.NameCountTypeFull Name
1BMA4Ligand/IonBETA-D-MANNOSE
2CA-1Ligand/IonCALCIUM ION
3GAL4Ligand/IonBETA-D-GALACTOSE
4MAN8Ligand/IonALPHA-D-MANNOSE
5MN-1Ligand/IonMANGANESE (II) ION
6NAG16Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (4, 32)
No.NameCountTypeFull Name
1BMA4Ligand/IonBETA-D-MANNOSE
2CA-1Ligand/IonCALCIUM ION
3GAL4Ligand/IonBETA-D-GALACTOSE
4MAN8Ligand/IonALPHA-D-MANNOSE
5MN-1Ligand/IonMANGANESE (II) ION
6NAG16Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (24, 24)

Asymmetric Unit (24, 24)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:145 , ASP A:147 , ASP A:155 , HIS A:160 , HOH A:2101 , HOH A:2102binding site for residue MN A 2001
02AC2SOFTWAREASP A:147 , LEU A:149 , ASN A:151 , ASP A:155 , HOH A:2103 , HOH A:2104binding site for residue CA A 2002
03AC3SOFTWAREGLU B:145 , ASP B:147 , ASP B:155 , HIS B:160 , HOH B:2101 , HOH B:2103binding site for residue MN B 2001
04AC4SOFTWAREASP B:147 , LEU B:149 , ASN B:151 , ASP B:155 , HOH B:2102 , HOH B:2104binding site for residue CA B 2002
05AC5SOFTWAREGLU C:145 , ASP C:147 , ASP C:155 , HIS C:160 , HOH C:2101 , HOH C:2102binding site for residue MN C 2001
06AC6SOFTWAREASP C:147 , LEU C:149 , ASN C:151 , ASP C:155 , HOH C:2103 , HOH C:2104binding site for residue CA C 2002
07AC7SOFTWAREGLU D:145 , ASP D:147 , ASP D:155 , HIS D:160 , HOH D:2101 , HOH D:2102binding site for residue MN D 2001
08AC8SOFTWAREASP D:147 , LEU D:149 , ASN D:151 , ASP D:155 , HOH D:2103 , HOH D:2104binding site for residue CA D 2002
09AC9SOFTWAREGLU E:145 , ASP E:147 , ASP E:155 , HIS E:160 , HOH E:2101 , HOH E:2102binding site for residue MN E 2001
10AD1SOFTWAREASP E:147 , LEU E:149 , ASN E:151 , ASP E:155 , HOH E:2103 , HOH E:2104binding site for residue CA E 2002
11AD2SOFTWAREGLU F:145 , ASP F:147 , ASP F:155 , HIS F:160 , HOH F:2101 , HOH F:2102binding site for residue MN F 2001
12AD3SOFTWAREASP F:147 , LEU F:149 , ASN F:151 , ASP F:155 , HOH F:2103 , HOH F:2104binding site for residue CA F 2002
13AD4SOFTWAREGLU G:145 , ASP G:147 , ASP G:155 , HIS G:160 , HOH G:2101 , HOH G:2102binding site for residue MN G 2001
14AD5SOFTWAREASP G:147 , LEU G:149 , ASN G:151 , ASP G:155 , HOH G:2103 , HOH G:2104binding site for residue CA G 2002
15AD6SOFTWAREGLU H:145 , ASP H:147 , ASP H:155 , HIS H:160 , HOH H:2101 , HOH H:2102binding site for residue MN H 2001
16AD7SOFTWAREASP H:147 , LEU H:149 , ASN H:151 , ASP H:155 , HOH H:2103 , HOH H:2104binding site for residue CA H 2002
17AD8SOFTWAREASP A:122 , LYS A:123 , GLY A:125 , LEU A:126 , ASN A:151 , TRP A:154 , ILE A:236 , THR A:237 , ASN A:240binding site for Poly-Saccharide residues NAG A 2003 through NAG A 2010
18AD9SOFTWAREASP A:122 , LYS A:123 , GLY A:125 , LEU A:126 , ASN A:151 , TRP A:154 , ILE A:236 , THR A:237 , ASN A:240 , ASP B:122 , LYS B:123 , GLY B:124 , GLY B:125 , LEU B:126 , LEU B:149 , ASN B:151 , HIS B:153 , TRP B:154 , ILE B:236 , THR B:237 , ASN B:240 , THR F:83 , GLY F:84binding site for Poly-Saccharide residues NAG B 2003 through NAG B 2010
19AE1SOFTWAREASP B:122 , LYS B:123 , GLY B:124 , GLY B:125 , LEU B:126 , LEU B:149 , ASN B:151 , HIS B:153 , TRP B:154 , ILE B:236 , THR B:237 , ASN B:240 , ASP C:122 , LYS C:123 , GLY C:124 , GLY C:125 , LEU C:126 , TYR C:150 , ASN C:151 , HIS C:153 , TRP C:154 , ILE C:236 , THR C:237 , ASN C:240 , GLY E:84 , SER E:192 , SER E:193 , LYS E:219 , THR F:83 , GLY F:84binding site for Poly-Saccharide residues NAG C 2003 through NAG C 2010
20AE2SOFTWAREASP C:122 , LYS C:123 , GLY C:124 , GLY C:125 , LEU C:126 , TYR C:150 , ASN C:151 , HIS C:153 , TRP C:154 , ILE C:236 , THR C:237 , ASN C:240 , ASP D:122 , LYS D:123 , GLY D:125 , LEU D:126 , TYR D:150 , ASN D:151 , HIS D:153 , TRP D:154 , ILE D:236 , THR D:237 , ASN D:240 , GLY E:84 , SER E:192 , SER E:193 , LYS E:219binding site for Poly-Saccharide residues NAG D 2003 through NAG D 2010
21AE3SOFTWAREASP D:122 , LYS D:123 , GLY D:125 , LEU D:126 , TYR D:150 , ASN D:151 , HIS D:153 , TRP D:154 , ILE D:236 , THR D:237 , ASN D:240 , ASP E:122 , LYS E:123 , GLY E:124 , GLY E:125 , TYR E:150 , ASN E:151 , HIS E:153 , TRP E:154 , ILE E:236 , THR E:237 , ASN E:240binding site for Poly-Saccharide residues NAG E 2003 through NAG E 2010
22AE4SOFTWAREASP E:122 , LYS E:123 , GLY E:124 , GLY E:125 , TYR E:150 , ASN E:151 , HIS E:153 , TRP E:154 , ILE E:236 , THR E:237 , ASN E:240 , ASP F:122 , LYS F:123 , GLY F:124 , GLY F:125 , LEU F:149 , ASN F:151 , HIS F:153 , TRP F:154 , ILE F:236 , THR F:237 , ASN F:240binding site for Poly-Saccharide residues NAG F 2003 through NAG F 2010
23AE5SOFTWAREASP F:122 , LYS F:123 , GLY F:124 , GLY F:125 , LEU F:149 , ASN F:151 , HIS F:153 , TRP F:154 , ILE F:236 , THR F:237 , ASN F:240 , SER G:65 , ASP G:107 , ASP G:122 , GLY G:124 , GLY G:125 , LEU G:126 , ASN G:151 , HIS G:153 , TRP G:154 , ILE G:236 , THR G:237 , ASN G:240binding site for Poly-Saccharide residues NAG G 2003 through NAG G 2010
24AE6SOFTWARESER G:65 , ASP G:107 , ASP G:122 , GLY G:124 , GLY G:125 , LEU G:126 , ASN G:151 , HIS G:153 , TRP G:154 , ILE G:236 , THR G:237 , ASN G:240 , ASP H:122 , LYS H:123 , GLY H:124 , GLY H:125 , TYR H:150 , ASN H:151 , HIS H:153 , TRP H:154 , ILE H:236 , THR H:237 , ASN H:240binding site for Poly-Saccharide residues NAG H 2003 through NAG H 2010

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5AVA)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Ala A:106 -Asp A:107
2Ala B:106 -Asp B:107
3Ala C:106 -Asp C:107
4Ala D:106 -Asp D:107
5Ala E:106 -Asp E:107
6Ala F:106 -Asp F:107
7Ala G:106 -Asp G:107
8Ala H:106 -Asp H:107

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5AVA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5AVA)

(-) Exons   (0, 0)

(no "Exon" information available for 5AVA)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava A  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain B from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh..............eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeeee....eeeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava B  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain C from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeeee....eeeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava C  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain D from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh..............eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeeee....eeeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava D  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain E from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh........hhhhh.eeeeee............eeeeee......eeee........eeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava E  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain F from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh..............eeeeee............eeeeee......eeee........eeeeeeee....eeeeeeee....eeeeeeee.........eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava F  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain G from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee..........eeeeeeeee.......hhhhh..............eeeeee............eeeeee.......eee.......eeeeeeeee....eeeeeee......eeeeeee.........eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava G  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251        


Chain H from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...hhh.eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeeee.........eeeeeeee........hhhhh..............eeeeee............eeeeee......eeee......eeeeeeeeee....eeeeeeee....eeeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ava H  22 ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT 259
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5AVA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5AVA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5AVA)

(-) Gene Ontology  (3, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:106 - Asp A:107   [ RasMol ]  
    Ala B:106 - Asp B:107   [ RasMol ]  
    Ala C:106 - Asp C:107   [ RasMol ]  
    Ala D:106 - Asp D:107   [ RasMol ]  
    Ala E:106 - Asp E:107   [ RasMol ]  
    Ala F:106 - Asp F:107   [ RasMol ]  
    Ala G:106 - Asp G:107   [ RasMol ]  
    Ala H:106 - Asp H:107   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ava
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHAE_PHAVU | P05088
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  V5YN37_PHAVU | V5YN37
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PHAE_PHAVU | P05088
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  V5YN37_PHAVU | V5YN37
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PHAE_PHAVU | P05088: 3wcr 3wcs 3wog
        V5YN37_PHAVU | V5YN37: 3wcr 3wcs 3wog

(-) Related Entries Specified in the PDB File

5av7