Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DIONAIN-1, THE MAJOR ENDOPEPTIDASE IN THE VENUS FLYTRAP DIGESTIVE JUICE
 
Authors :  M. W. Risor, L. R. Thomsen, K. W. Sanggaard, T. A. Nielsen, I. B. Thogerse M. V. Lukassen, L. Rossen, I. Garcia-Ferrer, T. Guevara, E. Meinjohan N. C. Nielsen, F. X. Gomis-Ruth, J. J. Enghild
Date :  12 May 15  (Deposition) - 09 Dec 15  (Release) - 10 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Hydrolase, Cysteine Peptidase, Venus Flytrap, Digestive Enzyme, Acidic Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. W. Risor, L. R. Thomsen, K. W. Sanggaard, T. A. Nielsen, I. B. Thogersen, M. V. Lukassen, L. Rossen, I. Garcia-Ferrer, T. Guevara, C. Scavenius, E. Meinjohanns, F. X. Gomis-Ruth, J. J. Enghild
Enzymatic And Structural Characterization Of The Major Endopeptidase In The Venus Flytrap Digestion Fluid.
J. Biol. Chem. V. 291 2271 2016
PubMed-ID: 26627834  |  Reference-DOI: 10.1074/JBC.M115.672550

(-) Compounds

Molecule 1 - DIONAIN-1
    Chains: A
    Engineered: YES
    Expression System: KOMAGATAELLA PASTORIS
    Expression System Plasmid: PPICZALPHAC
    Expression System Strain: KM71H
    Expression System Taxid: 4922
    Fragment: MATURE ENZYME
    Organism Common: VENUS FLYTRAP
    Organism Scientific: DIONAEA MUSCIPULA
    Organism Taxid: 4362
    Other Details: FROM THE PLANT DIGESTIVE JUICE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1E641Ligand/IonN-[N-[1-HYDROXYCARBOXYETHYL-CARBONYL]LEUCYLAMINO-BUTYL]-GUANIDINE
2PO41Ligand/IonPHOSPHATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:20 , GLY A:24 , CYS A:25 , CYS A:26 , TRP A:27 , GLY A:68 , GLY A:69 , ASP A:164 , HIS A:165 , HOH A:2057 , HOH A:2122 , HOH A:2255BINDING SITE FOR RESIDUE E64 A1224
2AC2SOFTWAREALA A:4 , GLN A:128 , TYR A:172 , GLY A:173 , THR A:174 , SER A:181 , MET A:203 , HOH A:2204 , HOH A:2262BINDING SITE FOR RESIDUE PO4 A1225

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:23 -A:66
2A:57 -A:102
3A:159 -A:212

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:157 -Pro A:158
2Ala A:207 -Pro A:208

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5A24)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5A24)

(-) Exons   (0, 0)

(no "Exon" information available for 5A24)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:222
                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eehhhhh............hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.....hhh...hhhhhhhhhhhhh..........hhhhh.....hhhhh.......eeee....hhhhhhhhhh...eeeee...hhhhhh....ee.........eeeeeeeeee......eeeeee...........eeeee.......hhhhh...eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5a24 A   2 VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA 223
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5A24)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5A24)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5A24)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5A24)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    E64  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:207 - Pro A:208   [ RasMol ]  
    Gly A:157 - Pro A:158   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5a24
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0E3GLN3_D | A0A0E3GLN3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A0E3GLN3_D | A0A0E3GLN3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5A24)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5A24)