Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  K. LACTIS LST4 LONGIN DOMAIN
 
Authors :  A. Pacitto, D. B. Ascher, T. L. Blundell
Date :  21 May 15  (Deposition) - 13 Apr 16  (Release) - 13 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.14
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  C  (1x)
Biol. Unit 2:  A  (1x)
Biol. Unit 3:  B  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Longin, Denn, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Pacitto, D. B. Ascher, L. H. Wong, B. K. Blaszczyk, R. K. Nookala, N. Zhang, S. Dokudovskaya, T. P. Levine, T. L. Blundell
Lst4, The Yeast Fnip1/2 Orthologue, Is A Denn-Family Protein.
Open Biology V. 5 50174 2015
PubMed-ID: 26631379  |  Reference-DOI: 10.1098/RSOB.150174

(-) Compounds

Molecule 1 - PROTEIN LST4
    ChainsC, A, B, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 58-226
    GeneLST4, KLLA0A06622G
    Organism CommonYEAST
    Organism ScientificKLUYVEROMYCES LACTIS
    Organism Taxid28985

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)  C 
Biological Unit 2 (1x)A   
Biological Unit 3 (1x) B  
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4ZY8)

(-) Sites  (0, 0)

(no "Site" information available for 4ZY8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZY8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZY8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZY8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZY8)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZY8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee.......hhhhhhhhhh...hhhhhh.eeeeeeeehhh.eeeeeeeee.......eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zy8 A  10 GFRLIISQELNYQVVLDHSSVNFAHIPLNELKDYIFGSIRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDDVLPVLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHCIEVAAVLQTFQRKIIPLLSGYSL 172
                                    19|       36  ||    49      ||60        70        80        90       100       110       120       130       140 ||    156       166      
                                    19|          39|           56|                                                                                 142|                       
                                     27           43            58                                                                                  149                       

Chain B from PDB  Type:PROTEIN  Length:144
                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee....eeeeeee......hhhhhhhhhhhhhhhh.eeeeeeee....eeeeeeeee.......eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4zy8 B  10 GFRLIISQELNYQVVLDHSSVNFHIPLNELKDYIFRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDDVLPVLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHDWKARNCIEVAAVLQTFQRKIIPLLS 168
                                    19|       36   ||   50    ||  64        74        84        94       104       114       124       134       144       154       164    
                                    19|           40|        55|                                                                                                            
                                     27            45         60                                                                                                            

Chain C from PDB  Type:PROTEIN  Length:144
                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee...eeeeeee......hhhhhhhhhhh..........eeeeeeehhh.eeeeeeeee.......eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4zy8 C   9 GGFRLIISQELYQVVLDHSSVNFHIPLNELKDYIFGSIRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDDVLPVLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHDWNCIEVAAVLQTFQRKIIPLLS 168
                                    18||      36  ||    50     || 61        71        81        91       101       111       121       131       141  ||   154       164    
                                     19|         39|          56|                                                                                   144|                    
                                      28          44           58                                                                                    148                    

Chain D from PDB  Type:PROTEIN  Length:145
                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee...eeeeeeee....hhhhhhhhhh..hhhhhh.eeeeeeeehhh.eeeeeeeee.......eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zy8 D  10 GFRLIISQELGNYQVVLDHSSVHIPLNELKDYIFGIRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDDVLPVLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHDWKARNCIEVAAVLQTFQRKIIPLLS 168
                                    19||      35 ||     51    ||  63        73        83        93       103       113       123       133       143       153       163     
                                     20|        37|          56|                                                                                                             
                                      27         44           59                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZY8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZY8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZY8)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4zy8)
 
  Sites
(no "Sites" information available for 4zy8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zy8)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zy8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LST4_KLULA | Q6CXP4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LST4_KLULA | Q6CXP4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4ZY8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZY8)