Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ENGINEERED CARBONIC ANHYDRASE IX MIMIC IN COMPLEX WITH GLUCOSYL SULFAMATE INHIBITOR
 
Authors :  B. P. Mahon, C. L. Lomelino, A. L. Salguero, R. Mckenna
Date :  19 May 15  (Deposition) - 28 Oct 15  (Release) - 28 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Carbonic Anhydrase Ix Mimic, Glucosyl Sulfamate, Complex, Lyase-Lyase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. P. Mahon, C. L. Lomelino, J. Ladwig, G. M. Rankin, J. M. Driscoll, A. L. Salguero, M. A. Pinard, D. Vullo, C. T. Supuran, S. A. Poulsen, R. Mckenna
Mapping Selective Inhibition Of The Cancer-Related Carbonic Anhydrase Ix Using Structure-Activity Relationships Of Glucosyl-Based Sulfamates.
J. Med. Chem. V. 58 6630 2015
PubMed-ID: 26203869  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B00845

(-) Compounds

Molecule 1 - CARBONIC ANHYDRASE 2
    Chains: A
    EC Number: 4.2.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 4-260
    Gene: CA2
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CARBONATE DEHYDRATASE II,CARBONIC ANHYDRASE C,CAC,CARBONIC ANHYDRASE II,CA-II

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
15KZ1Ligand/Ion(1S)-2,3,4,6-TETRA-O-ACETYL-1,5-ANHYDRO-1-{[5-(SULFAMOYLOXY)PENTYL]SULFAMOYL}-D-ALLITOL
2DMS2Ligand/IonDIMETHYL SULFOXIDE
3ZN1Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:94 , HIS A:96 , HIS A:119 , 5KZ A:304binding site for residue ZN A 301
2AC2SOFTWARETYR A:7 , ASP A:243 , TRP A:245binding site for residue DMS A 302
3AC3SOFTWARETYR A:51 , PHE A:179 , ASP A:180 , ARG A:182 , HOH A:528binding site for residue DMS A 303
4AC4SOFTWARETRP A:5 , PHE A:20 , HIS A:94 , HIS A:96 , HIS A:119 , VAL A:121 , VAL A:131 , GLY A:132 , VAL A:143 , LEU A:198 , THR A:199 , PRO A:201 , PRO A:202 , TRP A:209 , ZN A:301 , HOH A:428 , HOH A:446 , HOH A:556binding site for residue 5KZ A 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZWX)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ser A:29 -Pro A:30
2Pro A:201 -Pro A:202

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZWX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZWX)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZWX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:257
                                                                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhh......ee.....ee......eeee.....eeeeee....eeeee.......eeee......eeeeeeeeee..........ee......eeeeeeeee.hhhhhhhhh.....eeeeeeeeee...hhhhhhhhhhhhhhh....eee....hhhhhh.....eeeeee..........eeeeee...eeehhhhhhhhh.............................ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zwx A   4 HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK 261
                                    13        23        33        43        53        63        73        83        93       103       113       123 ||    134       144       154       164       174       184       194       204       214       224       234       244       254       
                                                                                                                                                   125|                                                                                                                                      
                                                                                                                                                    127
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZWX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZWX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZWX)

(-) Gene Ontology  (39, 39)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5KZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:201 - Pro A:202   [ RasMol ]  
    Ser A:29 - Pro A:30   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zwx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAH2_HUMAN | P00918
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAH2_HUMAN | P00918
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAH2_HUMAN | P00918: 12ca 1a42 1am6 1avn 1bcd 1bic 1bn1 1bn3 1bn4 1bnm 1bnn 1bnq 1bnt 1bnu 1bnv 1bnw 1bv3 1ca2 1ca3 1cah 1cai 1caj 1cak 1cal 1cam 1can 1cao 1cay 1caz 1ccs 1cct 1ccu 1cil 1cim 1cin 1cnb 1cnc 1cng 1cnh 1cni 1cnj 1cnk 1cnw 1cnx 1cny 1cra 1cva 1cvb 1cvc 1cvd 1cve 1cvf 1cvh 1dca 1dcb 1eou 1f2w 1fql 1fqm 1fqn 1fqr 1fr4 1fr7 1fsn 1fsq 1fsr 1g0e 1g0f 1g1d 1g3z 1g45 1g46 1g48 1g4j 1g4o 1g52 1g53 1g54 1h4n 1h9n 1h9q 1hca 1hea 1heb 1hec 1hed 1hva 1i8z 1i90 1i91 1i9l 1i9m 1i9n 1i9o 1i9p 1i9q 1if4 1if5 1if6 1if7 1if8 1if9 1kwq 1kwr 1lg5 1lg6 1lgd 1lug 1lzv 1moo 1mua 1okl 1okm 1okn 1oq5 1ray 1raz 1rza 1rzb 1rzc 1rzd 1rze 1t9n 1tb0 1tbt 1te3 1teq 1teu 1tg3 1tg9 1th9 1thk 1ttm 1uga 1ugb 1ugc 1ugd 1uge 1ugf 1ugg 1xeg 1xev 1xpz 1xq0 1yda 1ydb 1ydc 1ydd 1yo0 1yo1 1yo2 1z9y 1ze8 1zfk 1zfq 1zge 1zgf 1zh9 1zsa 1zsb 1zsc 2abe 2aw1 2ax2 2ca2 2cba 2cbb 2cbc 2cbd 2cbe 2eu2 2eu3 2ez7 2f14 2fmg 2fmz 2fnk 2fnm 2fnn 2foq 2fos 2fou 2fov 2gd8 2geh 2h15 2h4n 2hd6 2hkk 2hl4 2hnc 2hoc 2ili 2nng 2nno 2nns 2nnv 2nwo 2nwp 2nwy 2nwz 2nxr 2nxs 2nxt 2o4z 2osf 2osm 2pou 2pov 2pow 2q1b 2q1q 2q38 2qo8 2qoa 2qp6 2vva 2vvb 2wd2 2wd3 2weg 2weh 2wej 2weo 2x7s 2x7t 2x7u 3b4f 3bet 3bl0 3bl1 3c7p 3ca2 3caj 3cyu 3d8w 3d92 3d93 3d9z 3daz 3dbu 3dc3 3dc9 3dcc 3dcs 3dcw 3dd0 3dd8 3dv7 3dvb 3dvc 3dvd 3efi 3eft 3f4x 3f8e 3ffp 3gz0 3hfp 3hkn 3hkq 3hkt 3hku 3hlj 3hs4 3ibi 3ibl 3ibn 3ibu 3ieo 3igp 3k2f 3k34 3k7k 3kig 3kkx 3kne 3koi 3kok 3kon 3ks3 3kwa 3l14 3m04 3m14 3m1j 3m1k 3m1q 3m1w 3m2n 3m2x 3m2y 3m2z 3m3x 3m40 3m5e 3m5s 3m5t 3m67 3m96 3m98 3mhc 3mhi 3mhl 3mhm 3mho 3ml2 3mmf 3mna 3mnh 3mni 3mnj 3mnk 3mnu 3mwo 3myq 3mzc 3n0n 3n2p 3n3j 3n4b 3nb5 3ni5 3nj9 3oik 3oil 3oim 3oku 3okv 3oy0 3oyq 3oys 3p3h 3p3j 3p44 3p4v 3p55 3p58 3p5a 3p5l 3pjj 3po6 3pyk 3qyk 3r16 3r17 3rg3 3rg4 3rge 3rj7 3rld 3ryj 3ryv 3ryx 3ryy 3ryz 3rz0 3rz1 3rz5 3rz7 3rz8 3s71 3s72 3s73 3s74 3s75 3s76 3s77 3s78 3s8x 3s9t 3sap 3sax 3sbh 3sbi 3t5u 3t5z 3t82 3t83 3t84 3t85 3tmj 3tvn 3tvo 3u3a 3u45 3u47 3u7c 3v2j 3v2m 3v3f 3v3g 3v3h 3v3i 3v3j 3v5g 3v7x 3vbd 3zp9 4bcw 4bf1 4bf6 4ca2 4cac 4cq0 4dz7 4dz9 4e3d 4e3f 4e3g 4e3h 4e49 4e4a 4e5q 4fik 4fl7 4fpt 4frc 4fu5 4fvn 4fvo 4g0c 4gl1 4hba 4hew 4hey 4hez 4hf3 4ht0 4idr 4ilx 4ito 4itp 4iwz 4js6 4jsa 4jss 4jsw 4jsz 4k0s 4k0t 4k0z 4k13 4k1q 4kap 4kni 4knj 4kuv 4kuw 4kuy 4kv0 4l5u 4l5v 4l5w 4lhi 4lp6 4m2r 4m2u 4m2v 4m2w 4mdg 4mdl 4mdm 4mlt 4mlx 4mo8 4mty 4n0x 4n16 4pq7 4pxx 4pyx 4pyy 4pzh 4q06 4q07 4q08 4q09 4q49 4q6d 4q6e 4q78 4q7p 4q7s 4q7v 4q7w 4q81 4q83 4q87 4q8x 4q8y 4q8z 4q90 4q99 4q9y 4qef 4qiy 4qjm 4qk1 4qk2 4qk3 4qsa 4qsb 4qsi 4qtl 4qy3 4r59 4r5a 4r5b 4rfc 4rfd 4rh2 4riu 4riv 4rn4 4rux 4ruy 4ruz 4wl4 4ww6 4xe1 4y0j 4ygj 4ygk 4ygl 4ygn 4yvy 4ywp 4yx4 4yxi 4yxo 4yxu 4yyt 4z0q 4z1e 4z1j 4z1k 4z1n 4zao 4zwi 4zwy 4zwz 4zx0 4zx1 5a6h 5amd 5amg 5aml 5bnl 5bru 5brv 5brw 5byi 5c8i 5ca2 5cac 5cjl 5clu 5dog 5doh 5drs 5dsi 5dsj 5dsk 5dsl 5dsm 5dsn 5dso 5dsp 5dsq 5dsr 5e28 5e2k 5e2r 5e2s 5eh5 5eh7 5eh8 5ehe 5ehv 5ehw 5eij 5ekh 5ekj 5ekm 5eoi 5fdc 5fdi 5flo 5flp 5flq 5flr 5fls 5flt 5fng 5fnh 5fni 5fnj 5fnk 5fnl 5fnm 5g01 5g03 5g0b 5g0c 5gmn 5j8z 5jdv 5je7 5jeg 5jeh 5jep 5jes 5jg3 5jg5 5jgs 5jgt 5jmz 5jn1 5jn3 5jn7 5jq0 5jqt 5l3o 5l6k 5l6t 5l70 5l9e 5ljq 5ljt 5lmd 5lvs 5n0d 5n0e 5sz0 5sz1 5sz2 5sz3 5sz4 5sz5 5sz6 5sz7 5th4 5thi 5thj 5thn 5ti0 6ca2 7ca2 8ca2 9ca2

(-) Related Entries Specified in the PDB File

4zwi 4zwy 4zwz 4zx0 4zx1