Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HYDROXYLASE DOMAIN OF SCS7P
 
Authors :  G. Zhu, M. Koszelak-Rosenblum, M. G. Malkowski, Membrane Protein St Biology Consortium (Mpsbc)
Date :  11 May 15  (Deposition) - 29 Jul 15  (Release) - 23 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Fatty Acid Hydroxylase, Scs7P, Fah1P, Fa2H Homolog, Structural Genomics, Psi-Biology, Membrane Protein Structural Biology Consortium, Mpsbc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Zhu, M. Koszelak-Rosenblum, S. M. Connelly, M. E. Dumont, M. G. Malkowski
The Crystal Structure Of An Integral Membrane Fatty Acid Alpha-Hydroxylase.
J. Biol. Chem. V. 290 29820 2015
PubMed-ID: 26515067  |  Reference-DOI: 10.1074/JBC.M115.680124

(-) Compounds

Molecule 1 - CERAMIDE VERY LONG CHAIN FATTY ACID HYDROXYLASE SCS7
    Chains: A, B
    EC Number: 1.-.-.-
    Engineered: YES
    Expression System: SACCHAROMYCES CEREVISIAE
    Expression System Plasmid: PSGP46
    Expression System Strain: BJ5460
    Expression System Taxid: 4932
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 96-384
    Gene: SCS7, FAH1, YMR272C, YM8156.14C
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE (STRAIN ATCC 204508 / S288C)
    Organism Taxid: 559292
    Strain: ATCC 204508 / S288C
    Synonym: CERAMIDE VLCFA HYDROXYLASE SCS7,SUPPRESSOR OF CALCIUM SENSITIVITY 7

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 20)

Asymmetric Unit (3, 20)
No.NameCountTypeFull Name
1BOG8Ligand/IonB-OCTYLGLUCOSIDE
2TRD8Ligand/IonTRIDECANE
3ZN4Ligand/IonZINC ION
Biological Unit 1 (2, 8)
No.NameCountTypeFull Name
1BOG6Ligand/IonB-OCTYLGLUCOSIDE
2TRD2Ligand/IonTRIDECANE
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 8)
No.NameCountTypeFull Name
1BOG2Ligand/IonB-OCTYLGLUCOSIDE
2TRD6Ligand/IonTRIDECANE
3ZN-1Ligand/IonZINC ION

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:271 , HIS A:326 , HIS A:330 , HIS A:345 , HIS A:349binding site for residue ZN A 401
02AC2SOFTWAREHIS A:244 , HIS A:249 , HIS A:268 , HIS A:272 , HIS A:348binding site for residue ZN A 402
03AC3SOFTWARELEU A:193 , THR A:194 , LEU A:266 , LEU A:267 , HIS A:271 , ARG A:280 , LEU A:281 , MET A:283 , PRO A:284 , LEU A:287binding site for residue BOG A 403
04AC4SOFTWAREASN A:221 , GLN A:222 , LEU A:223 , PHE A:224 , PHE A:337binding site for residue BOG A 404
05AC5SOFTWARECYS A:321 , PHE A:328 , SER A:332 , LYS A:333 , BOG A:406binding site for residue BOG A 405
06AC6SOFTWAREPHE A:328 , BOG A:405 , BOG A:407binding site for residue BOG A 406
07AC7SOFTWARETRP A:198 , LYS A:278 , BOG A:406 , BOG A:408 , TYR B:211binding site for residue BOG A 407
08AC8SOFTWARETRP A:199 , BOG A:407 , TYR B:211 , TYR B:296 , TYR B:309binding site for residue BOG A 408
09AC9SOFTWARETRP A:236 , LEU A:243 , PHE A:288 , VAL A:299 , GLY A:311 , GLY A:315binding site for residue TRD A 409
10AD1SOFTWARECYS A:292 , LYS A:297 , TRD B:407binding site for residue TRD A 410
11AD2SOFTWAREHIS B:271 , HIS B:326 , HIS B:330 , HIS B:345 , HIS B:349binding site for residue ZN B 401
12AD3SOFTWAREHIS B:244 , HIS B:249 , HIS B:268 , HIS B:272 , HIS B:348binding site for residue ZN B 402
13AD4SOFTWAREVAL A:203 , ALA A:204 , TRP A:205 , PRO B:192 , LYS B:195 , ALA B:204 , PRO B:285binding site for residue BOG B 403
14AD5SOFTWARETRP B:253binding site for residue BOG B 404
15AD6SOFTWARETRP B:236 , LEU B:243 , CYS B:292 , VAL B:299 , GLY B:311 , GLY B:315binding site for residue TRD B 405
16AD7SOFTWARELEU B:193 , THR B:194 , LEU B:266 , LEU B:267 , ARG B:280 , LEU B:281 , MET B:283binding site for residue TRD B 406
17AD8SOFTWAREPRO A:207 , TYR A:211 , TRD A:410 , TRP B:199 , TRD B:409binding site for residue TRD B 407
18AD9SOFTWAREPHE B:328binding site for residue TRD B 408
19AE1SOFTWARETRD B:407binding site for residue TRD B 409
20AE2SOFTWAREVAL B:210 , GLY B:214 , VAL B:215 , LYS B:218binding site for residue TRD B 410

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZR1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZR1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZR1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZR1)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZR1)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhh...hhhhhhhhhh......hhhhhhhh...hhhhhhhhhh................hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhh..............ee..ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zr1 A 117 FDSTTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDAPLSKMKYESGLEVL 390
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386    


Chain B from PDB  Type:PROTEIN  Length:275
                                                                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhh....hhhhhhhhhh......hhhhhhhh...hhhhhhhhhh................hhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..........hhhhhhh..............ee..ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zr1 B 117 FDSTTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDAPLSKMKYESGLEVLF 391
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZR1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZR1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZR1)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BOG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zr1)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zr1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SCS7_YEAST | Q03529
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.-.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SCS7_YEAST | Q03529
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SCS7_YEAST | Q03529: 4zr0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZR1)