Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF EIF2B BETA FROM CHAETOMIUM THERMOPHILUM
 
Authors :  B. Kuhle, R. Ficner
Date :  20 Apr 15  (Deposition) - 30 Sep 15  (Release) - 25 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.55
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Eif2B, Eif2, Guanine Nucleotide Exchange Factor, Gef, Regulatory Subcomplex, Regulatory Subunit, Translation Initiation, Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Kuhle, N. K. Eulig, R. Ficner
Architecture Of The Eif2B Regulatory Subcomplex And Its Implications For The Regulation Of Guanine Nucleotide Exchange On Eif2.
Nucleic Acids Res. V. 43 9994 2015
PubMed-ID: 26384431  |  Reference-DOI: 10.1093/NAR/GKV930

(-) Compounds

Molecule 1 - TRANSLATION INITIATION FACTOR EIF2B-LIKE PROTEIN, TRANSLATION INITIATION FACTOR EIF2B-LIKE PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PGEX-6P1
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: CTHT_0063470
    Organism Scientific: CHAETOMIUM THERMOPHILUM
    Organism Taxid: 209285

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4ZEM)

(-) Sites  (0, 0)

(no "Site" information available for 4ZEM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZEM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZEM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZEM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZEM)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZEM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:328
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhh.eeee....hhhhhhhhh.eeeee..ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh.....hhhhhhh....eeeehhhhh.eeee..eeehhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zem A  10 PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASDIASDAASDIQSKSMFNLLSVQPFSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNPQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDEVSRGELTTTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQV 417
                                    19        29        39        49        59        69        79        89        99     ||115      |151      |180       190       200       210       220       230       240       250 ||    267       277       287       297       307       317       327       337       347  ||   379       389       399       409        
                                                                                                                         105|       122|      158|                                                                       252|                                                                                       350|                                            
                                                                                                                          112        149       178                                                                        260                                                                                        373                                            


Chain B from PDB  Type:PROTEIN  Length:298
                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhh.eeeee..hhhhhhh....eeeee..eee....eeee.hhhhhhhhhhhh...eeee.hhh.ee........eeeehhhhh.eeee..eeehhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zem B  10 PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDETTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQVGE 419
                                    19        29        39        49        59        69        79        89        99     ||184       194       204       214       224       234       244      |262       272       282       292       302       312       322       332       342 ||    381       391       401       411        
                                                                                                                         105|                                                                   251|                                                                                 344|                                             
                                                                                                                          181                                                                    260                                                                                  374
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZEM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZEM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZEM)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4zem)
 
  Sites
(no "Sites" information available for 4zem)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zem)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zem
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0SEE6_CHATD | G0SEE6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G0SEE6_CHATD | G0SEE6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G0SEE6_CHATD | G0SEE6: 5dbo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZEM)