Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  ABC TRANSPORTER / PERIPLASMIC BINDING PROTEIN FROM BRUCELLA OVIS WITH GLUTATHIONE BOUND
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  10 Apr 15  (Deposition) - 17 Jun 15  (Release) - 17 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,E  (1x)
Biol. Unit 3:  C,F  (1x)
Keywords :  Abc Transporter, Glutathione, Gsh, Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Ssgcid, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Abc Transporter / Periplasmic Binding Protein From Brucella Ovis With Glutathione Bound
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - AMINO ACID ABC TRANSPORTER, PERIPLASMIC AMINO ACID-BINDING PROTEIN
    ChainsA, B, C, D, E, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneBOV_0736
    Organism ScientificBRUCELLA OVIS (STRAIN ATCC 25840 / 63/290 / NCTC 10512)
    Organism Taxid444178
    StrainATCC 25840 / 63/290 / NCTC 10512

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A  D  
Biological Unit 2 (1x) B  E 
Biological Unit 3 (1x)  C  F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 20)

Asymmetric Unit (3, 20)
No.NameCountTypeFull Name
1EDO8Ligand/Ion1,2-ETHANEDIOL
2GSH6Ligand/IonGLUTATHIONE
3NA6Ligand/IonSODIUM ION
Biological Unit 1 (2, 5)
No.NameCountTypeFull Name
1EDO3Ligand/Ion1,2-ETHANEDIOL
2GSH2Ligand/IonGLUTATHIONE
3NA-1Ligand/IonSODIUM ION
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1EDO3Ligand/Ion1,2-ETHANEDIOL
2GSH2Ligand/IonGLUTATHIONE
3NA-1Ligand/IonSODIUM ION
Biological Unit 3 (2, 4)
No.NameCountTypeFull Name
1EDO2Ligand/Ion1,2-ETHANEDIOL
2GSH2Ligand/IonGLUTATHIONE
3NA-1Ligand/IonSODIUM ION

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:19 , THR A:20 , ASN A:62 , ALA A:63 , ARG A:66 , ARG A:80 , ASN A:81 , THR A:82 , THR A:83 , ARG A:88 , GLN A:131 , THR A:134 , THR A:135 , ILE A:159 , THR A:176 , ASP A:177 , SER A:180 , HOH A:521 , HOH A:570binding site for residue GSH A 401
02AC2SOFTWAREASP A:89 , LEU A:94 , ASP A:95 , GLN A:212 , ASP D:219binding site for residue NA A 402
03AC3SOFTWAREARG A:88 , GLY A:133 , THR A:134 , HOH A:520 , HOH A:607binding site for residue EDO A 403
04AC4SOFTWAREASN A:310 , LYS A:311 , HOH A:667binding site for residue EDO A 404
05AC5SOFTWAREASP A:219 , ASP D:89 , LEU D:94 , ASP D:95 , GLN D:212binding site for residue NA A 405
06AC6SOFTWAREASN B:19 , THR B:20 , ASN B:62 , ALA B:63 , ARG B:66 , ARG B:80 , ASN B:81 , THR B:82 , THR B:83 , ARG B:88 , GLN B:131 , THR B:134 , THR B:135 , ILE B:159 , THR B:176 , ASP B:177 , SER B:180 , HOH B:566 , HOH B:568binding site for residue GSH B 401
07AC7SOFTWAREASP B:89 , LEU B:94 , ASP B:95 , GLN B:212 , ASP E:219binding site for residue NA B 402
08AC8SOFTWAREARG B:88 , GLY B:133 , THR B:134 , THR B:135 , HOH B:521 , HOH B:593binding site for residue EDO B 403
09AC9SOFTWARELYS B:148 , MET B:149 , GLU B:150 , HOH B:520binding site for residue EDO B 404
10AD1SOFTWAREASP B:219 , ASP E:89 , LEU E:94 , ASP E:95 , GLN E:212binding site for residue NA B 405
11AD2SOFTWAREASN C:19 , THR C:20 , ASN C:62 , ALA C:63 , ARG C:66 , ARG C:80 , ASN C:81 , THR C:82 , THR C:83 , ARG C:88 , GLN C:131 , THR C:134 , THR C:135 , ILE C:159 , THR C:176 , ASP C:177 , SER C:180 , HOH C:517 , HOH C:582binding site for residue GSH C 401
12AD3SOFTWAREASP C:89 , LEU C:94 , ASP C:95 , GLN C:212 , ASP F:219binding site for residue NA C 402
13AD4SOFTWAREARG C:88 , GLY C:133 , THR C:134 , HOH C:510 , HOH C:572 , HOH C:623binding site for residue EDO C 403
14AD5SOFTWAREASP C:219 , ASP F:89 , LEU F:94 , ASP F:95 , GLN F:212binding site for residue NA C 404
15AD6SOFTWAREASN D:19 , THR D:20 , ASN D:62 , ALA D:63 , ARG D:66 , ARG D:80 , ASN D:81 , THR D:82 , THR D:83 , ARG D:88 , GLN D:131 , THR D:134 , THR D:135 , THR D:176 , ASP D:177 , SER D:180 , HOH D:553 , HOH D:598binding site for residue GSH D 401
16AD7SOFTWAREARG D:88 , GLY D:133 , THR D:134 , THR D:135 , HOH D:546 , HOH D:587binding site for residue EDO D 402
17AD8SOFTWAREASN E:19 , THR E:20 , ASN E:62 , ALA E:63 , ARG E:66 , ARG E:80 , ASN E:81 , THR E:82 , THR E:83 , ARG E:88 , GLN E:131 , THR E:134 , THR E:135 , ILE E:159 , THR E:176 , ASP E:177 , SER E:180 , HOH E:528 , HOH E:636binding site for residue GSH E 401
18AD9SOFTWAREARG E:88 , GLY E:133 , THR E:134 , THR E:135 , HOH E:505 , HOH E:529 , HOH E:557binding site for residue EDO E 402
19AE1SOFTWAREASN F:19 , THR F:20 , ASN F:62 , ALA F:63 , ARG F:66 , ARG F:80 , ASN F:81 , THR F:82 , THR F:83 , ARG F:88 , GLN F:131 , THR F:134 , THR F:135 , ILE F:159 , THR F:176 , ASP F:177 , SER F:180 , HOH F:542 , HOH F:602binding site for residue GSH F 401
20AE2SOFTWAREARG F:88 , GLY F:133 , THR F:134 , THR F:135 , HOH F:504 , HOH F:537 , HOH F:657binding site for residue EDO F 402

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1B:129 -B:171
2D:129 -D:171

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4Z9N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z9N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z9N)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z9N)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:320
                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.eeeee........ee.....eehhhhhhhhhhhhhhhh....eeeee....hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhhhh.hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhh....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9n A   2 ADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321

Chain B from PDB  Type:PROTEIN  Length:324
                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhh.eeeee........ee.....eehhhhhhhhhhhhhhhh....eeeee....hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhhh..hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhhh...hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z9n B  -2 HHHHADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317    

Chain C from PDB  Type:PROTEIN  Length:320
                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.eeeee........ee.....eehhhhhhhhhhhhhhhh....eeeee....hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhhh..hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhh....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9n C   2 ADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321

Chain D from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh.eeeee........ee.....eehhhhhhhhhhhhhhhh....eeeee....hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhh...hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhh....hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9n D   1 HADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320 

Chain E from PDB  Type:PROTEIN  Length:320
                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.eeeee........ee.....eehhhhhhhhhhhhhhhh....eeeee....hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhh...hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhhh...hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9n E   2 ADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321

Chain F from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh.eeeeee.......ee.....eehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhh....ee......hhhhhhh..eeeeeeeeee.eeeeee........hhhhh...eeeee..hhhhhhhhhhhhhh....eeeee.hhhhhhhhhhh....eeeeehhhhhhhhhh..hhh.eee.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhh......hhhhhhh...hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z9n F   1 HADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 321
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z9N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z9N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z9N)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4Z9N)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4z9n)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z9n
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0M3KL33_B | A0A0M3KL33
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0A0M3KL33_B | A0A0M3KL33
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4Z9N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z9N)