Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF INSULIN REGULATED AMINOPEPTIDASE IN COMPLEX WITH LIGAND
 
Authors :  A. Mpakali, E. Saridakis, K. Harlos, Y. Zhao, E. Stratikos
Date :  07 Apr 15  (Deposition) - 26 Aug 15  (Release) - 16 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.31
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Aminopeptidase, Antigen Presentation, Transition-State Analogue, Enzyme Inhibitor, Hydrolase, Irap (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Mpakali, E. Saridakis, K. Harlos, Y. Zhao, A. Papakyriakou, P. Kokkala, D. Georgiadis, E. Stratikos
Crystal Structure Of Insulin-Regulated Aminopeptidase With Bound Substrate Analogue Provides Insight On Antigenic Epitope Precursor Recognition And Processing.
J Immunol. V. 195 2842 2015
PubMed-ID: 26259583  |  Reference-DOI: 10.4049/JIMMUNOL.1501103

(-) Compounds

Molecule 1 - LEUCYL-CYSTINYL AMINOPEPTIDASE
    Chains: A, B
    EC Number: 3.4.11.3
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Common: HUMAN
    Expression System Taxid: 9606
    Fragment: UNP RESIDUES 155-1025
    Gene: LNPEP, OTASE
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CYSTINYL AMINOPEPTIDASE,INSULIN-REGULATED MEMBRANE AMINOPEPTIDASE,INSULIN-RESPONSIVE AMINOPEPTIDASE,IRAP,OXYTOCINASE, OTASE,PLACENTAL LEUCINE AMINOPEPTIDASE,P-LAP
 
Molecule 2 - DG025 TRANSITION-STATE ANALOGUE ENZYME INHIBITOR
    Chains: C, D
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 34)

Asymmetric Unit (5, 34)
No.NameCountTypeFull Name
12X02Mod. Amino Acid[(1R)-1-AMINO-3-PHENYLPROPYL]PHOSPHONIC ACID
24L82Mod. Amino Acid(2R)-2-(AMINOMETHYL)-4-METHYLPENTANOIC ACID
3MAN1Ligand/IonALPHA-D-MANNOSE
4NAG27Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN2Ligand/IonZINC ION
Biological Unit 1 (4, 18)
No.NameCountTypeFull Name
12X01Mod. Amino Acid[(1R)-1-AMINO-3-PHENYLPROPYL]PHOSPHONIC ACID
24L81Mod. Amino Acid(2R)-2-(AMINOMETHYL)-4-METHYLPENTANOIC ACID
3MAN1Ligand/IonALPHA-D-MANNOSE
4NAG15Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 14)
No.NameCountTypeFull Name
12X01Mod. Amino Acid[(1R)-1-AMINO-3-PHENYLPROPYL]PHOSPHONIC ACID
24L81Mod. Amino Acid(2R)-2-(AMINOMETHYL)-4-METHYLPENTANOIC ACID
3MAN-1Ligand/IonALPHA-D-MANNOSE
4NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION

(-) Sites  (25, 25)

Asymmetric Unit (25, 25)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:464 , HIS A:468 , GLU A:487 , 2X0 C:1binding site for residue ZN A 1101
02AC2SOFTWAREHIS B:464 , HIS B:468 , GLU B:487 , 2X0 D:1binding site for residue ZN B 1101
03AC3SOFTWAREASN B:525 , ASN B:638binding site for residue NAG B 1109
04AC4SOFTWAREHIS A:182 , PRO A:183 , ASN A:184 , ASP A:322binding site for Poly-Saccharide residues NAG A 1102 through NAG A 1103 bound to ASN A 184
05AC5SOFTWAREARG A:191 , ASN A:215 , NAG A:1107binding site for Mono-Saccharide NAG A 1104 bound to ASN A 215
06AC6SOFTWAREGLY A:254 , ASN A:256binding site for Mono-Saccharide NAG A 1105 bound to ASN A 256
07AC7SOFTWAREASN A:266 , NAG A:1104binding site for Poly-Saccharide residues NAG A 1106 through NAG A 1107 bound to ASN A 266
08AC8SOFTWAREASN A:368 , SER A:370 , TYR A:381 , HOH A:1203binding site for Mono-Saccharide NAG A 1108 bound to ASN A 368
09AC9SOFTWARELEU A:574 , ASN A:578 , HIS A:579binding site for Poly-Saccharide residues NAG A 1112 through MAN A 1114 bound to ASN A 578
10AD1SOFTWAREASN A:598binding site for Poly-Saccharide residues NAG A 1116 through NAG A 1117 bound to ASN A 598
11AD2SOFTWAREVAL A:680 , ASN A:682 , HOH A:1201 , HOH A:1204binding site for Mono-Saccharide NAG A 1109 bound to ASN A 682
12AD3SOFTWARETYR A:721 , ASN A:760binding site for Mono-Saccharide NAG A 1110 bound to ASN A 760
13AD4SOFTWAREGLN A:804 , ASN A:834binding site for Mono-Saccharide NAG A 1115 bound to ASN A 834
14AD5SOFTWAREASN A:850 , LYS A:880binding site for Mono-Saccharide NAG A 1111 bound to ASN A 850
15AD6SOFTWAREPRO B:183 , ASN B:184 , LEU B:185 , THR B:186 , ASP B:322 , TYR B:325binding site for Mono-Saccharide NAG B 1102 bound to ASN B 184
16AD7SOFTWAREASN B:256binding site for Poly-Saccharide residues NAG B 1103 through NAG B 1104 bound to ASN B 256
17AD8SOFTWAREGLY B:213 , ASN B:266binding site for Mono-Saccharide NAG B 1105 bound to ASN B 266
18AD9SOFTWAREASN B:368binding site for Mono-Saccharide NAG B 1106 bound to ASN B 368
19AE1SOFTWAREASN B:374 , GLN B:411binding site for Mono-Saccharide NAG B 1110 bound to ASN B 374
20AE2SOFTWAREASN B:578 , HIS B:579 , ASP B:588 , ASP B:591binding site for Mono-Saccharide NAG B 1113 bound to ASN B 578
21AE3SOFTWARETYR B:658 , TYR B:668 , ILE B:681 , ASN B:682binding site for Mono-Saccharide NAG B 1107 bound to ASN B 682
22AE4SOFTWAREGLN B:804 , GLN B:806 , ASN B:834 , HOH B:1201binding site for Poly-Saccharide residues NAG B 1111 through NAG B 1112 bound to ASN B 834
23AE5SOFTWARETHR B:648 , SER B:649 , ASN B:850 , LYS B:880binding site for Mono-Saccharide NAG B 1108 bound to ASN B 850
24AE6SOFTWAREALA A:429 , ILE A:461 , HIS A:464 , GLU A:465 , PHE A:544 , TYR A:549 , 2X0 C:1 , HIS C:4 , HOH C:101binding site for Di-peptide 4L8 C 2 and LYS C 3
25AE7SOFTWAREALA B:429 , ILE B:461 , HIS B:464 , PHE B:544 , TYR B:549 , 2X0 D:1 , HIS D:4binding site for Di-peptide 4L8 D 2 and LYS D 3

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:828 -A:835
2B:828 -B:835

(-) Cis Peptide Bonds  (7, 7)

Asymmetric Unit
No.Residues
1Glu A:295 -Pro A:296
2Thr A:597 -Asn A:598
3Glu B:229 -Lys B:230
4Glu B:295 -Pro B:296
5Asn B:594 -Glu B:595
6Thr B:648 -Ser B:649
7Pro B:655 -Leu B:656

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z7I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z7I)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z7I)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:859
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeeeeeeeee....eeeeeeeeeee......eeeee....eeeeee.............eee.....eeeee.........eeeeeeeeee.......eeeeeee.......eeeeeee....hhhhhh..........eeeeeee.....eeee...eeeee.......eeeeee....hhhhh.eeee.....eeee..eeee....hhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeee............eeeee.hhh.......hhhhhhhhhhhhhhhhhhhhh....ee.hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.............hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eehhhhhhhh..............hhhhhhh....eeeeee...eeeee.................eeeee.....eeeee......eeeee.......eee.hhhh...eeeehhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.........hhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh.....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4z7i A  159 KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL 1025
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638||     656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976       986       996      1006      1016         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          639|                                                                                                                                                                                                                                                                                                                                                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           648                                                                                                                                                                                                                                                                                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:852
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............eeeeeeeeeeeee....eeeeeeeeeeee.....eeeee....eeeee..............ee....eeeee.........eeeeeeeeee.......eeeeee.........eeeeee....hhhhhh..........eeeeeee......eee...eeeee.......eeee......hhhhh.eeee.....ee.....eee..........hhhhhhhhhhhhhhhhhhhh......eeeeeee.......eee..eeeee.hhh.......hhhhhhhhhhhhhhhhhhhhh....ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhh.hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh..eehhhhhhhh.............hhhhhhh....eeeeee...eeeee..................eee..............eeeee.......eee........eeeehhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh....hhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4z7i B  160 LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNDTSYLWHIPLSYVTEGRKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL 1025
                                   169       179       189       199       209       219   ||  231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591    || 602       612       622       632     ||650       660  ||   673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023  
                                                                                         223|                                                                                                                                                                                                                                                                                                                                                                               596|                                     638|             663|                                                                                                                                                                                                                                                                                                                                                                      
                                                                                          226                                                                                                                                                                                                                                                                                                                                                                                598                                      647              667                                                                                                                                                                                                                                                                                                                                                                      


Chain C from PDB  Type:PROTEIN  Length:10
                                           
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                4z7i C    1 xxKHHAFSFK   10
                            ||      10
                            1-2X0     
                             2-4L8    


Chain D from PDB  Type:PROTEIN  Length:5
                                      
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                4z7i D    1 xxKHH    5
                            ||   
                            1-2X0
                             2-4L8
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z7I)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z7I)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z7I)

(-) Gene Ontology  (31, 31)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2X0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    4L8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn B:594 - Glu B:595   [ RasMol ]  
    Glu A:295 - Pro A:296   [ RasMol ]  
    Glu B:229 - Lys B:230   [ RasMol ]  
    Glu B:295 - Pro B:296   [ RasMol ]  
    Pro B:655 - Leu B:656   [ RasMol ]  
    Thr A:597 - Asn A:598   [ RasMol ]  
    Thr B:648 - Ser B:649   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z7i
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LCAP_HUMAN | Q9UIQ6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.11.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LCAP_HUMAN | Q9UIQ6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LCAP_HUMAN | Q9UIQ6: 4p8q 4pj6 5c97 5jhq 5mj6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z7I)