Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ENGINEERED TGAMA1 LACKING THE DII LOOP
 
Authors :  M. L. Parker, M. J. Boulanger
Date :  02 Mar 15  (Deposition) - 20 May 15  (Release) - 20 May 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.93
Chains :  Asym./Biol. Unit :  A
Keywords :  Apicomplexa, Invasion, Moving Junction, Parasite, Protein Engineering, Pan Domain, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. L. Parker, M. J. Boulanger
An Extended Surface Loop On Toxoplasma Gondii Apical Membrane Antigen 1 (Ama1) Governs Ligand Binding Selectivity.
Plos One V. 10 26206 2015
PubMed-ID: 25955165  |  Reference-DOI: 10.1371/JOURNAL.PONE.0126206

(-) Compounds

Molecule 1 - APICAL MEMBRANE ANTIGEN AMA1
    Chains: A
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Common: CABBAGE LOOPER
    Expression System Taxid: 7111
    Expression System Vector: PACGP67B
    Expression System Vector Type: BACULOVIRUS
    Fragment: RESIDUES 64-484
    Gene: TGME49_255260
    Organism Scientific: TOXOPLASMA GONDII ME49
    Organism Taxid: 508771

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 10)

Asymmetric/Biological Unit (5, 10)
No.NameCountTypeFull Name
1CD2Ligand/IonCADMIUM ION
2CL2Ligand/IonCHLORIDE ION
3CO3Ligand/IonCOBALT (II) ION
4GOL2Ligand/IonGLYCEROL
5NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:250 , GLU A:316 , CL A:504 , CL A:505binding site for residue CD A 502
02AC2SOFTWAREGLU A:177 , GLU A:180 , ASP A:332 , HOH A:657 , HOH A:659binding site for residue CD A 503
03AC3SOFTWARELYS A:327 , CD A:502binding site for residue CL A 504
04AC4SOFTWARELYS A:181 , ASP A:250 , ASN A:331 , ARG A:369 , CD A:502binding site for residue CL A 505
05AC5SOFTWAREASP A:102 , HIS A:363 , HOH A:604 , HOH A:630 , HOH A:648binding site for residue CO A 506
06AC6SOFTWAREHIS A:266 , HOH A:693 , HOH A:724 , HOH A:725binding site for residue CO A 507
07AC7SOFTWAREGLU A:83 , HIS A:89 , HIS A:90 , LYS A:285 , HOH A:611 , HOH A:622 , HOH A:643 , HOH A:650binding site for residue CO A 508
08AC8SOFTWAREASP A:141 , VAL A:142 , GLU A:147 , ARG A:170 , HOH A:737binding site for residue GOL A 509
09AC9SOFTWARETYR A:213 , TYR A:230 , SER A:232 , HOH A:647 , HOH A:768 , HOH A:788binding site for residue GOL A 510
10AD1SOFTWAREASN A:86 , HIS A:89 , VAL A:390binding site for Mono-Saccharide NAG A 501 bound to ASN A 86

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:117 -A:286
2A:194 -A:226
3A:242 -A:255
4A:304 -A:393
5A:324 -A:384
6A:435 -A:459

(-) Cis Peptide Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1Pro A:132 -Pro A:133
2Asn A:153 -Pro A:154
3Ser A:172 -Pro A:173
4Glu A:247 -Pro A:248
5Pro A:339 -Gly A:340

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YIV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YIV)

(-) Exons   (0, 0)

(no "Exon" information available for 4YIV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:374
                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh................eeeee..eeeee......ee..eeee.................hhhhhhhhh.....................eehhhhhh.......hhhhhhhhhhhh................eeee....eeee...........................eeee........eeeehhhhhh...hhhhhh....eeeeeeeeee..eeee.hhh...eeee..hhhhhhhhhhhh...................eeeeee.....eeeeee.....eeeeeeeeeeee.........hhhhh.................ee.........eeeeeee..eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yiv A  69 GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPGQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPSVTPPTTALQCPDSFGACDVQACKRQKTSCVGGQIQSTSV 469
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338 ||    368       378       388       398       408       418       428|   || 445       455       465    
                                                                                                                                                                                                                                                                                                         340|                                                                428| 435|                            
                                                                                                                                                                                                                                                                                                          361                                                                 431  441
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YIV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YIV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YIV)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:153 - Pro A:154   [ RasMol ]  
    Glu A:247 - Pro A:248   [ RasMol ]  
    Pro A:132 - Pro A:133   [ RasMol ]  
    Pro A:339 - Gly A:340   [ RasMol ]  
    Ser A:172 - Pro A:173   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yiv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S8GKS3_TOXGM | S8GKS3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  S8GKS3_TOXGM | S8GKS3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        S8GKS3_TOXGM | S8GKS3: 4yiz

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YIV)