Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA
 
Authors :  J. P. Hallinan, B. K. Kaiser, B. L. Stoddard
Date :  27 Feb 15  (Deposition) - 09 Mar 16  (Release) - 15 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Hydrolase-Dna Complex, Laglidadg, Homing Endonuclease, Meganuclease (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. R. Lambert, J. P. Hallinan, B. W. Shen, J. K. Chik, J. M. Bolduc, N. Kulshina, L. I. Robins, B. K. Kaiser, J. Jarjour, K. Havens, A. M. Scharenberg, B. L. Stoddard
Indirect Dna Sequence Recognition And Its Impact On Nucleas Cleavage Activity.
Structure V. 24 862 2016
PubMed-ID: 27133026  |  Reference-DOI: 10.1016/J.STR.2016.03.024

(-) Compounds

Molecule 1 - RIBOSOMAL PROTEIN 3/HOMING ENDONUCLEASE-LIKE FUSION PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 420-727
    Gene: RPS3/HEG FUSION
    Organism Scientific: GROSMANNIA PENICILLATA
    Organism Taxid: 360150
 
Molecule 2 - DNA (27-MER)
    Chains: B
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES
 
Molecule 3 - DNA (27-MER)
    Chains: C
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1CA3Ligand/IonCALCIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:18 , GLU A:183 , HOH A:552 , DC B:15 , DA C:16 , HOH C:135binding site for residue CA A 401
2AC2SOFTWAREGLU A:19 , GLU A:183 , DC B:15 , DA B:16 , DT C:15 , DA C:16binding site for residue CA A 402
3AC3SOFTWAREGLU A:19 , GLY A:182 , HOH A:555 , DA B:16 , HOH B:145 , DT C:15binding site for residue CA A 403

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YHX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YHX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YHX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YHX)

(-) Exons   (0, 0)

(no "Exon" information available for 4YHX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhheeeeeeeee.......eeeeeeeeeeee..hhhhhhhhhhhhh..eeeee...eeeeee.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhh..............hhhhhhhhhhhheeeeeeeee......eeeeeeeeeeehhhhhhhhhhhhhhhh..eeeeeee..eeeeeeee.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4yhx A   4 NESINPWVLTGFADAEGSFILRIRNNNKSSAGYSTELGFQITLHKKDKSILENIQSTWKVGVIANSGDNAVSLKVTRFEDLRVVLNHFEKYPLITQKLGDYLLFKQAFSVMENKEHLKIEGIKRLVGIKANLNWGLTDELKEAFVASGGENIFNKNIPNSGWLAGFTSGEGCFFVSLIKSKSKLGVQVQLVFSITQHARDRELMDNLVTYLGCGYIKEKKKSEFSWLEFVVTKFSDIKDKIIPVFQENNIIGVKLEDFEDWCKVAKLIEEKKHLTESGLEEIRNIKLNMNKGRV 307
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153  ||   173       183       193       203       213       223       233       243       253       263       273       283       293       303    
                                                                                                                                                                                  156|                                                                                                                                            
                                                                                                                                                                                   167                                                                                                                                            


Chain B from PDB  Type:DNA  Length:27
                                                           
                 4yhx B   1 CCTTTCCGCTTATTCAACCCTTTACCC  27
                                    10        20       


Chain C from PDB  Type:DNA  Length:27
                                                           
                 4yhx C   1 GGTAAAGGGTTGAATAAGCGGAAAGGG  27
                                    10        20
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YHX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YHX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YHX)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4yhx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yhx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C7SQG1_9PEZI | C7SQG1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C7SQG1_9PEZI | C7SQG1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4YHX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YHX)