Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CARBONIC ANHYDRASE CAH3 FROM CHLAMYDOMONAS REINHARDTII IN COMPLEX WITH PHOSPHATE.
 
Authors :  T. Hainzl, C. Grundstrom, R. Benlloch, D. Shevela, T. Shutova, J. Messi G. Samuelsson, A. E. Sauer-Eriksson
Date :  08 Jan 15  (Deposition) - 11 Feb 15  (Release) - 11 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,G  (1x)
Biol. Unit 2:  B,H  (1x)
Biol. Unit 3:  C,E  (1x)
Biol. Unit 4:  D,F  (1x)
Keywords :  Photosystem Ii-Associated, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Benlloch, D. Shevela, T. Hainzl, C. Grundstrom, T. Shutova, J. Messinger, G. Samuelsson, A. E. Sauer-Eriksson
Crystal Structure And Functional Characterization Of Photosystem Ii-Associated Carbonic Anhydrase Cah3 In Chlamydomonas Reinhardtii.
Plant Physiol. V. 167 950 2015
PubMed-ID: 25617045  |  Reference-DOI: 10.1104/PP.114.253591

(-) Compounds

Molecule 1 - CARBONIC ANHYDRASE, ALPHA TYPE
    Chains: A, B, C, D, E, F, G, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 73-310
    Gene: CAH3
    Organism Scientific: CHLAMYDOMONAS REINHARDTII
    Organism Taxid: 3055
    Synonym: INTRACELLULAR CARBONIC ANHYDRASE,ALPHA TYPE

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): A     G 
Biological Unit 2 (1x):  B     H
Biological Unit 3 (1x):   C E   
Biological Unit 4 (1x):    D F  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 32)

Asymmetric Unit (2, 32)
No.NameCountTypeFull Name
12HP24Ligand/IonDIHYDROGENPHOSPHATE ION
2ZN8Ligand/IonZINC ION
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
12HP6Ligand/IonDIHYDROGENPHOSPHATE ION
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 7)
No.NameCountTypeFull Name
12HP7Ligand/IonDIHYDROGENPHOSPHATE ION
2ZN-1Ligand/IonZINC ION
Biological Unit 3 (1, 7)
No.NameCountTypeFull Name
12HP7Ligand/IonDIHYDROGENPHOSPHATE ION
2ZN-1Ligand/IonZINC ION
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
12HP4Ligand/IonDIHYDROGENPHOSPHATE ION
2ZN-1Ligand/IonZINC ION

(-) Sites  (32, 32)

Asymmetric Unit (32, 32)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:160 , HIS A:162 , HIS A:179 , 2HP A:402binding site for residue ZN A 401
02AC2SOFTWAREHIS A:160 , HIS A:162 , HIS A:179 , LEU A:253 , THR A:254 , THR A:255 , ZN A:401binding site for residue 2HP A 402
03AC3SOFTWAREGLY A:200 , ASP A:275 , HOH A:525 , SER G:276binding site for residue 2HP A 403
04AC4SOFTWAREASP A:118 , PHE A:119 , LYS A:238 , ARG A:244 , 2HP A:405 , ARG F:95binding site for residue 2HP A 404
05AC5SOFTWAREASP A:118 , 2HP A:404 , HOH A:502 , HOH A:503 , HOH A:506 , GLY F:93 , LYS F:94 , ARG F:95 , GLU F:260binding site for residue 2HP A 405
06AC6SOFTWAREHIS B:160 , HIS B:162 , HIS B:179 , 2HP B:402binding site for residue ZN B 401
07AC7SOFTWAREHIS B:160 , HIS B:162 , HIS B:179 , LEU B:253 , THR B:254 , THR B:255 , ZN B:401 , HOH B:516 , HOH B:531binding site for residue 2HP B 402
08AC8SOFTWAREASP B:280 , ARG B:283 , TYR B:291 , HOH H:527binding site for residue 2HP B 403
09AC9SOFTWAREPRO B:199 , GLY B:200 , ASP B:275 , HOH B:519 , HOH B:532 , HOH B:533binding site for residue 2HP B 404
10AD1SOFTWAREHIS C:160 , HIS C:162 , HIS C:179 , 2HP C:402binding site for residue ZN C 401
11AD2SOFTWAREHIS C:160 , HIS C:162 , HIS C:179 , LEU C:253 , THR C:254 , THR C:255 , ZN C:401 , HOH C:512binding site for residue 2HP C 402
12AD3SOFTWAREASP C:118 , 2HP C:404 , HOH C:501 , GLY G:93 , LYS G:94 , ARG G:95 , GLU G:260binding site for residue 2HP C 403
13AD4SOFTWAREASP C:118 , PHE C:119 , LYS C:238 , ARG C:244 , 2HP C:403 , HOH C:508 , HOH C:510 , ARG G:95binding site for residue 2HP C 404
14AD5SOFTWAREGLY C:200 , ASP C:275 , SER E:276binding site for residue 2HP C 405
15AD6SOFTWAREHIS D:160 , HIS D:162 , HIS D:179 , 2HP D:402binding site for residue ZN D 401
16AD7SOFTWAREHIS D:160 , HIS D:162 , HIS D:179 , LEU D:253 , THR D:254 , THR D:255 , ZN D:401binding site for residue 2HP D 402
17AD8SOFTWAREPRO D:199 , GLY D:200 , ASP D:275 , SER F:276binding site for residue 2HP D 403
18AD9SOFTWAREHIS E:160 , HIS E:162 , HIS E:179 , 2HP E:402binding site for residue ZN E 401
19AE1SOFTWAREHIS E:160 , HIS E:162 , HIS E:179 , LEU E:253 , THR E:254 , THR E:255 , ZN E:401binding site for residue 2HP E 402
20AE2SOFTWARELYS B:183 , GLY B:188 , LEU E:130 , LYS E:222 , GLU H:113binding site for residue 2HP E 403
21AE3SOFTWARESER C:276 , ASP C:280 , GLY E:200 , ASP E:275binding site for residue 2HP E 404
22AE4SOFTWAREHIS F:160 , HIS F:162 , HIS F:179 , 2HP F:402binding site for residue ZN F 401
23AE5SOFTWAREHIS F:160 , HIS F:162 , HIS F:179 , LEU F:253 , THR F:254 , THR F:255 , TRP F:264 , ZN F:401binding site for residue 2HP F 402
24AE6SOFTWAREPRO F:199 , ASP F:275binding site for residue 2HP F 403
25AE7SOFTWAREHIS G:160 , HIS G:162 , HIS G:179 , 2HP G:402binding site for residue ZN G 401
26AE8SOFTWAREHIS G:160 , HIS G:162 , HIS G:179 , THR G:254 , THR G:255 , TRP G:264 , ZN G:401binding site for residue 2HP G 402
27AE9SOFTWARESER A:276 , PRO G:199 , GLY G:200 , ASP G:275 , HOH G:511binding site for residue 2HP G 403
28AF1SOFTWAREHIS H:160 , HIS H:162 , HIS H:179 , THR H:254 , 2HP H:402binding site for residue ZN H 401
29AF2SOFTWAREHIS H:160 , HIS H:162 , HIS H:179 , LEU H:253 , THR H:254 , THR H:255 , ZN H:401binding site for residue 2HP H 402
30AF3SOFTWAREASP B:118 , GLY H:93 , LYS H:94 , ARG H:95 , GLU H:260 , 2HP H:404binding site for residue 2HP H 403
31AF4SOFTWAREPHE B:117 , ASP B:118 , PHE B:119 , LYS B:238 , ARG B:244 , 2HP H:403binding site for residue 2HP H 404
32AF5SOFTWARESER B:276 , GLY H:200 , ASP H:275 , HOH H:527binding site for residue 2HP H 405

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:90 -A:258
2B:90 -B:258
3C:90 -C:258
4D:90 -D:258
5E:90 -E:258
6F:90 -F:258
7G:90 -G:258
8H:90 -H:258

(-) Cis Peptide Bonds  (24, 24)

Asymmetric Unit
No.Residues
1Ser A:97 -Pro A:98
2Ala A:163 -Pro A:164
3Pro A:256 -Pro A:257
4Ser B:97 -Pro B:98
5Ala B:163 -Pro B:164
6Pro B:256 -Pro B:257
7Ser C:97 -Pro C:98
8Ala C:163 -Pro C:164
9Pro C:256 -Pro C:257
10Ser D:97 -Pro D:98
11Ala D:163 -Pro D:164
12Pro D:256 -Pro D:257
13Ser E:97 -Pro E:98
14Ala E:163 -Pro E:164
15Pro E:256 -Pro E:257
16Ser F:97 -Pro F:98
17Ala F:163 -Pro F:164
18Pro F:256 -Pro F:257
19Ser G:97 -Pro G:98
20Ala G:163 -Pro G:164
21Pro G:256 -Pro G:257
22Ser H:97 -Pro H:98
23Ala H:163 -Pro H:164
24Pro H:256 -Pro H:257

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XIX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XIX)

(-) Exons   (0, 0)

(no "Exon" information available for 4XIX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh......ee........ee......eee.......eeee.....eeee.....eeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh......eee.....hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix A  73 AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302        


Chain B from PDB  Type:PROTEIN  Length:237
                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh......ee................eee.......eeee.....eeee.....eeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh......eee.....hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix B  74 AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       


Chain C from PDB  Type:PROTEIN  Length:239
                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhh......ee........ee......eeee......eeee.....eeee....eeeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh......eee.....hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix C  72 MAAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301         


Chain D from PDB  Type:PROTEIN  Length:237
                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh......ee........ee......eee.......eeee.....eeee.....eeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh......eee.....hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix D  74 AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       


Chain E from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh......ee........ee......eeee......eeee.....eeee....eeeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh......eee.....hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix E  73 AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302        


Chain F from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh......ee........ee......eee.......eeee.....eeee.....eeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeeee.....hhhhhhhhhhh.....eeee.....hhhhhh..........eeeeee..........eeeeee...eeehhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix F  73 AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302        


Chain G from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhh......ee........ee......eee.......eeee.....eeee.....eeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeeee.....hhhhhhhhhhh......eee.....hhhhhh..........eeeeee..........eeeeee...eeehhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix G  73 AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302        


Chain H from PDB  Type:PROTEIN  Length:239
                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhh......ee...............eeeee......eeee.....eeee....eeeee..eeeeeeeeeee.....ee......eeeeeeeee.....eeeeeeeee......hhhhhhhhhhh..............hhhhhh..........eeeeeee.......eeeeeeee...ee.hhhhhhhhhhhhh....................eee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xix H  72 MAAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL 310
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XIX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XIX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XIX)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2HP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:163 - Pro A:164   [ RasMol ]  
    Ala B:163 - Pro B:164   [ RasMol ]  
    Ala C:163 - Pro C:164   [ RasMol ]  
    Ala D:163 - Pro D:164   [ RasMol ]  
    Ala E:163 - Pro E:164   [ RasMol ]  
    Ala F:163 - Pro F:164   [ RasMol ]  
    Ala G:163 - Pro G:164   [ RasMol ]  
    Ala H:163 - Pro H:164   [ RasMol ]  
    Pro A:256 - Pro A:257   [ RasMol ]  
    Pro B:256 - Pro B:257   [ RasMol ]  
    Pro C:256 - Pro C:257   [ RasMol ]  
    Pro D:256 - Pro D:257   [ RasMol ]  
    Pro E:256 - Pro E:257   [ RasMol ]  
    Pro F:256 - Pro F:257   [ RasMol ]  
    Pro G:256 - Pro G:257   [ RasMol ]  
    Pro H:256 - Pro H:257   [ RasMol ]  
    Ser A:97 - Pro A:98   [ RasMol ]  
    Ser B:97 - Pro B:98   [ RasMol ]  
    Ser C:97 - Pro C:98   [ RasMol ]  
    Ser D:97 - Pro D:98   [ RasMol ]  
    Ser E:97 - Pro E:98   [ RasMol ]  
    Ser F:97 - Pro F:98   [ RasMol ]  
    Ser G:97 - Pro G:98   [ RasMol ]  
    Ser H:97 - Pro H:98   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xix
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q39588_CHLRE | Q39588
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q39588_CHLRE | Q39588
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q39588_CHLRE | Q39588: 4xiw

(-) Related Entries Specified in the PDB File

4ciw 4XIW CONTAINS THE SAME PROTEIN COMPLEXED WITH ACETAZOLAMIDE