Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  E. COLI 5'-NUCLEOTIDASE MUTANT I521C LABELED WITH MTSL (INTERMEDIATE FORM)
 
Authors :  U. Krug, K. S. Paithankar, R. Schultz-Heienbrok, N. Strater
Date :  11 Nov 14  (Deposition) - 26 Nov 14  (Release) - 26 Nov 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.23
Chains :  Asym./Biol. Unit :  A
Keywords :  5Nt, Hydrolase, Phosphatase, Epr Label (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  U. Krug, K. S. Paithankar, R. Schultz-Heienbrok, N. Strater
E. Coli 5'-Nucleotidase Mutant I521C Labeled With Mtsl (Intermediate Form)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN USHA
    Chains: A
    EC Number: 3.6.1.45, 3.1.3.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 26-550
    Gene: USHA, B0480, JW0469
    Organism Scientific: ESCHERICHIA COLI K-12
    Organism Taxid: 83333
    Synonym: 5'-NUCLEOTIDASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 15)

Asymmetric/Biological Unit (5, 15)
No.NameCountTypeFull Name
1CO32Ligand/IonCARBONATE ION
2GOL1Ligand/IonGLYCEROL
3MTN1Ligand/IonS-[(1-OXYL-2,2,5,5-TETRAMETHYL-2,5-DIHYDRO-1H-PYRROL-3-YL)METHYL] METHANESULFONOTHIOATE
4SO49Ligand/IonSULFATE ION
5ZN2Ligand/IonZINC ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:93 , ASP A:120 , ASN A:121 , TYR A:420 , CYS A:521 , GLU A:524 , HOH A:878 , HOH A:1094binding site for residue MTN A 601
02AC2SOFTWAREASP A:84 , ASN A:116 , HIS A:217 , HIS A:252 , ZN A:603 , CO3 A:613binding site for residue ZN A 602
03AC3SOFTWAREASP A:41 , HIS A:43 , ASP A:84 , HIS A:252 , GLN A:254 , ZN A:602 , CO3 A:613binding site for residue ZN A 603
04AC4SOFTWARESER A:76 , ARG A:160 , GLN A:161 , HOH A:926binding site for residue SO4 A 604
05AC5SOFTWAREASP A:110 , LEU A:157 , PHE A:158 , LYS A:159 , ARG A:160 , HOH A:957 , HOH A:1018binding site for residue SO4 A 605
06AC6SOFTWAREARG A:102 , ASN A:105 , LYS A:134 , HOH A:1054 , HOH A:1126binding site for residue SO4 A 606
07AC7SOFTWAREARG A:102 , LYS A:131 , HOH A:1127binding site for residue SO4 A 607
08AC8SOFTWARETRP A:47 , ARG A:48 , HOH A:1100binding site for residue SO4 A 608
09AC9SOFTWARELYS A:421 , ASN A:422 , HOH A:797 , HOH A:953binding site for residue SO4 A 609
10AD1SOFTWARELEU A:475 , ASN A:476 , ASP A:477 , HOH A:891binding site for residue SO4 A 610
11AD2SOFTWARELYS A:33 , GLU A:69 , GLU A:73 , ARG A:297 , LEU A:334 , TYR A:335 , THR A:336 , HOH A:1060binding site for residue SO4 A 611
12AD3SOFTWAREARG A:375 , ARG A:379 , ARG A:410binding site for residue SO4 A 612
13AD4SOFTWAREASP A:84 , ASN A:116 , HIS A:117 , HIS A:252 , ZN A:602 , ZN A:603binding site for residue CO3 A 613
14AD5SOFTWARESER A:457 , GLY A:458 , HOH A:1069binding site for residue CO3 A 614
15AD6SOFTWAREASN A:105 , GLY A:108 , TYR A:109 , LYS A:134 , PHE A:135 , HOH A:957binding site for residue GOL A 615

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:258 -A:275
2A:521 -A:601

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:534 -Pro A:535

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WWL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WWL)

(-) Exons   (0, 0)

(no "Exon" information available for 4WWL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:525
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeee...............hhhhhhhhhhhhhhhhhhhh.eeeeee.......hhhhhh..hhhhhhhhhhhh..eee.hhhhhh.hhhhhhhhhhhh...ee...eee....ee....eeeeee..eeeeeeeee..hhhhhhhhhhhh.eee.hhhhhhhhhhhhhhhh....eeeeeee...hhhhh......hhhhhhhhh......eee.........eee..ee............eee..eeee.......eeeeeeeeee..eeeeeeeeeee...eeeee.....eeeee.......hhhhhhhhhhhhhhhhhhhh.eeeee......hhhhhh...hhhhhhhhhhhhhhhh..eeeee.hhh......eeeehhhhhhhh....eeeeeeeehhhhhhhhhhhh.........eeee.eeeeee..eeeeeee..ee.....eeeeeeehhhhhhhhhh........eeeeeeehhhhhhhhhhhhh..hhhhhh....eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wwl A  26 YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFCDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ 550
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WWL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WWL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WWL)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MTN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:534 - Pro A:535   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wwl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  USHA_ECOLI | P07024
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  3.6.1.45
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  USHA_ECOLI | P07024
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        USHA_ECOLI | P07024: 1ho5 1hp1 1hpu 1oi8 1oid 1oie 1ush 2ush

(-) Related Entries Specified in the PDB File

1hp1 1hpu 1oi8 1oid 1ush 2ush