Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN CALPAIN PEF(S) WITH (2Z,2Z')-2,2'-DISULFANEDIYLBIS(3-(6-BROMOINDOL-3-YL)ACRYLIC ACID) BOUND
 
Authors :  S. E. Adams, E. J. Robinson, P. J. Rizkallah, D. J. Miller, M. B. Hallett, R. K. Allemann
Date :  21 Oct 14  (Deposition) - 02 Sep 15  (Release) - 02 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.79
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Pef(S), Domain Vi, Calcium Binding Domain, Cysteine Protease, Mercaptoacrylic Acid, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. E. Adams, E. Robinson, P. J. Rizkallah, D. J. Miller, M. B. Hallett, R. K. Allemann
Conformationally Restricted Calpain Inhibitors
Chem Sci 2015
PubMed: search  |  Reference-DOI: 10.1039/C5SC01158B

(-) Compounds

Molecule 1 - CALPAIN SMALL SUBUNIT 1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21D
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 96-268
    Gene: CAPNS1, CAPN4, CAPNS
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CSS1,CALCIUM-ACTIVATED NEUTRAL PROTEINASE SMALL SUBUNIT,CANP SMALL SUBUNIT,CALCIUM-DEPENDENT PROTEASE SMALL SUBUNIT,CDPS,CALCIUM- DEPENDENT PROTEASE SMALL SUBUNIT 1,CALPAIN REGULATORY SUBUNIT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 12)

Asymmetric/Biological Unit (2, 12)
No.NameCountTypeFull Name
13SU4Ligand/Ion(2Z)-3-(6-BROMO-1H-INDOL-3-YL)-2-SULFANYLPROP-2-ENOICACID
2CA8Ligand/IonCALCIUM ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:109 , ASP A:112 , GLU A:114 , GLU A:119 , HOH A:416 , HOH A:451binding site for residue CA A 301
02AC2SOFTWAREASP A:152 , ASP A:154 , THR A:156 , LYS A:158 , GLU A:163 , HOH A:431binding site for residue CA A 302
03AC3SOFTWAREASP A:182 , ASP A:184 , SER A:186 , THR A:188 , GLU A:193 , HOH A:486binding site for residue CA A 303
04AC4SOFTWAREASP A:137 , ASP A:225 , ASP A:227 , ASN A:228 , HOH A:438 , HOH A:446binding site for residue CA A 304
05AC5SOFTWARELEU A:104 , VAL A:127 , ARG A:130 , HIS A:131 , TRP A:168 , 3SU A:306binding site for residue 3SU A 305
06AC6SOFTWARELEU A:124 , VAL A:127 , HIS A:131 , LEU A:134 , TRP A:168 , ILE A:171 , LYS A:172 , GLN A:175 , 3SU A:305binding site for residue 3SU A 306
07AC7SOFTWAREALA B:109 , ASP B:112 , GLU B:114 , GLU B:119 , HOH B:452 , HOH B:455binding site for residue CA B 301
08AC8SOFTWAREASP B:152 , ASP B:154 , THR B:156 , LYS B:158 , GLU B:163 , HOH B:450binding site for residue CA B 302
09AC9SOFTWAREASP B:182 , ASP B:184 , SER B:186 , THR B:188 , GLU B:193 , HOH B:461binding site for residue CA B 303
10AD1SOFTWAREASP B:137 , ASP B:225 , ASP B:227 , ASN B:228 , HOH B:453 , HOH B:457binding site for residue CA B 304
11AD2SOFTWAREGLU B:97 , GLN B:100 , VAL B:127 , ARG B:130 , HIS B:131 , TRP B:168 , LYS B:172 , 3SU B:306 , HOH B:539 , HOH B:540binding site for residue 3SU B 305
12AD3SOFTWARELEU B:124 , VAL B:127 , VAL B:128 , HIS B:131 , LYS B:172 , GLN B:175 , PHE B:226 , 3SU B:305 , HOH B:480 , HOH B:506binding site for residue 3SU B 306

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:305 -A:306
2B:305 -B:306

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WQ3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WQ3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WQ3)

(-) Exons   (0, 0)

(no "Exon" information available for 4WQ3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh......ee..hhhhhhhhh....hhhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhhhhhh.....eeeehhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wq3 A  96 EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS 268
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265   


Chain B from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh......eeeehhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wq3 B  96 EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS 268
                                   105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WQ3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WQ3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WQ3)

(-) Gene Ontology  (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3SU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wq3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wq3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CPNS1_HUMAN | P04632
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CPNS1_HUMAN | P04632
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CPNS1_HUMAN | P04632: 1kfu 1kfx 4phj 4phk 4phm 4wq2 5d69

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WQ3)