Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STATIONARY PHASE SURVIVAL PROTEIN YUIC FROM B.SUBTILIS COMPLEXED WITH NAG
 
Authors :  D. H. X. Quay, A. R. Cole, A. Cryar, K. Thalassinos, M. A. Williams, S. Bha N. H. Keep
Date :  01 Oct 14  (Deposition) - 08 Jul 15  (Release) - 21 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.21
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Lytic Transglycosylase, Peptidoglycan Remodelling, Stationary Phase, Mlta, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. H. Quay, A. R. Cole, A. Cryar, K. Thalassinos, M. A. Williams, S. Bhakta, N. H. Keep
Structure Of The Stationary Phase Survival Protein Yuic Fro B. Subtilis.
Bmc Struct. Biol. V. 15 12 2015
PubMed-ID: 26163297  |  Reference-DOI: 10.1186/S12900-015-0039-Z

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN YUIC
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC28-BSA4
    Expression System Taxid: 469008
    Expression System Variant: ROSETTA-2
    Expression System Vector Type: PLASMID
    Gene: YUIC, BSU32070
    Organism Scientific: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168
    Organism Taxid: 224308

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric/Biological Unit (3, 7)
No.NameCountTypeFull Name
13P91Ligand/Ion(2S)-2-{[(2S)-2-{[(2R)-2-HYDROXYPROPYL]OXY}PROPYL]OXY}PROPAN-1-OL
2DMS4Ligand/IonDIMETHYL SULFOXIDE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:100 , LYS A:102 , LEU A:111 , VAL A:118 , ASP A:151 , THR A:152 , GLY A:153 , HOH A:430 , HOH A:435 , HOH A:489 , HOH A:539 , HOH A:550binding site for residue NAG A 301
2AC2SOFTWAREGLN A:212 , ASN B:143 , TYR B:144 , HOH B:534 , HOH B:556binding site for residue DMS A 302
3AC3SOFTWARETHR B:100 , LYS B:102 , GLY B:105 , LEU B:111 , VAL B:118 , ASP B:151 , THR B:152 , GLY B:153 , DMS B:304 , HOH B:405 , HOH B:463 , HOH B:471 , HOH B:475 , HOH B:494binding site for residue NAG B 301
4AC4SOFTWARETYR B:109 , LEU B:111 , THR B:112 , TYR B:113 , LYS B:117 , VAL B:118 , HOH B:580binding site for residue 3P9 B 302
5AC5SOFTWAREPRO A:107 , GLU B:202 , THR B:203 , LYS B:204 , HOH B:429 , HOH B:514binding site for residue DMS B 303
6AC6SOFTWARETYR B:93 , SER B:99 , ALA B:127 , THR B:152 , GLY B:153 , ILE B:156 , ASP B:162 , NAG B:301 , HOH B:403 , HOH B:458binding site for residue DMS B 304
7AC7SOFTWARETYR B:83 , HOH B:532binding site for residue DMS B 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WJT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WJT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WJT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WJT)

(-) Exons   (0, 0)

(no "Exon" information available for 4WJT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.eeeeeeeee..hhhhhh.....................eeeeee.........eeee...eeeeeee........eeeee..hhhhhhhhh..eeeeeeeee......hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wjt A  72 KPLEEAFDWDEYPVQRVTATGYTAGAESTGKNPGDPLYGLTYSGVKVKRDLYSTVAADPSVFPIGTILFIPNYGLGVVADTGSAIKGNRLDLYFETVKDVYNEWGKKTLDVYVIKKGTGKITEDELEKLNETKSLQVFRNQYKTVK 217
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211      


Chain B from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.eeeeeeeee..hhhhhh.....................eeeeee.........eeee...eeeeeee........eeeee..hhhhhhhhh..eeeeeeeee......hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wjt B  72 KPLEEAFDWDEYPVQRVTATGYTAGAESTGKNPGDPLYGLTYSGVKVKRDLYSTVAADPSVFPIGTILFIPNYGLGVVADTGSAIKGNRLDLYFETVKDVYNEWGKKTLDVYVIKKGTGKITEDELEKLNETKSLQVFRNQYKTVK 217
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WJT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WJT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WJT)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3P9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wjt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wjt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YUIC_BACSU | O32108
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  YUIC_BACSU | O32108
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        YUIC_BACSU | O32108: 4wli 4wlk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WJT)