Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HIGH RESOLUTION CRYSTAL STRUCTURE OF CATALYTIC DOMAIN OF CHITINASE 60 FROM PSYCHROPHILIC BACTERIA MORITELLA MARINA.
 
Authors :  P. H. Malecki, C. E. Vorgias, W. Rypniewski
Date :  19 Aug 14  (Deposition) - 26 Aug 15  (Release) - 02 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.32
Chains :  Asym./Biol. Unit :  A
Keywords :  Tim Barrel, Catalytic Domain, High Resolution, Psychrophilic Chitinase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. H. Malecki, C. E. Vorgias, W. Rypniewski
High Resolution Crystal Structure Of Catalytic Domain Of Chitinase 60 From Psychrophilic Bacteria Moritella Marina.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CHITINASE 60
    Chains: A
    EC Number: 3.2.1.14
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CHI60
    Organism Scientific: VIBRIO MARINUS
    Organism Taxid: 90736
    Other Details: SIGNAL PEPTIDE HAS BEEN PROCESSED BY E. COLI.

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric/Biological Unit (4, 14)
No.NameCountTypeFull Name
1ACT3Ligand/IonACETATE ION
2CL2Ligand/IonCHLORIDE ION
3MPD1Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
4NA8Ligand/IonSODIUM ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETHR A:24 , ASN A:105 , GLY A:144 , ASP A:146 , HOH A:854binding site for residue NA A 401
02AC2SOFTWAREARG A:44 , TYR A:46 , ASP A:278 , ALA A:279 , TRP A:311 , TRP A:315 , CL A:408 , HOH A:634binding site for residue MPD A 402
03AC3SOFTWAREASP A:225 , HOH A:509 , HOH A:573 , HOH A:586binding site for residue NA A 403
04AC4SOFTWARETYR A:36 , ASP A:151 , GLN A:218 , TYR A:220 , TRP A:311 , HOH A:674 , HOH A:714binding site for residue ACT A 404
05AC5SOFTWAREHOH A:601 , HOH A:611 , HOH A:792binding site for residue NA A 405
06AC6SOFTWAREHOH A:501 , HOH A:507 , HOH A:578 , HOH A:603binding site for residue NA A 406
07AC7SOFTWAREASP A:30 , HOH A:540 , HOH A:557 , HOH A:722binding site for residue NA A 407
08AC8SOFTWARETRP A:40 , GLY A:43 , MPD A:402binding site for residue CL A 408
09AC9SOFTWAREVAL A:54 , GLU A:55 , THR A:58 , ARG A:126 , HOH A:510binding site for residue CL A 409
10AD1SOFTWARECYS A:53 , VAL A:54 , ILE A:90 , HOH A:596binding site for residue ACT A 410
11AD2SOFTWAREHOH A:742 , HOH A:831 , HOH A:864 , HOH A:865binding site for residue NA A 411
12AD3SOFTWAREHIS A:266 , HOH A:868 , HOH A:869 , HOH A:870 , HOH A:871 , HOH A:872binding site for residue NA A 412
13AD4SOFTWAREARG A:44 , GLY A:45 , TYR A:46binding site for residue ACT A 413
14AD5SOFTWARELYS A:85 , GLU A:94 , HOH A:504 , HOH A:610 , HOH A:770binding site for residue NA A 414

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:41 -A:53

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ser A:69 -Phe A:70
2Trp A:311 -Ser A:312

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4W5Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4W5Z)

(-) Exons   (0, 0)

(no "Exon" information available for 4W5Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:323
                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee....ee.....ee...hhhhh.....eeeeeee...hhhhh.......hhhhh.hhhhhhhhhhhhhhh..eeeeeeee..........hhhhhhhhhhhhhhhhh..eeeeee.hhhh...hhhhhhhhhhhhhhhhhhh.....eeee..hhhhhh....hhhhhhhh.....ee..........eeee...eeee..hhhhhhhhhhhhhhhhhhh.......hhhh.eeeee............hhhhhhhhhhhhhhh.....eeeeehhhhhh..........hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4w5z A  23 GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPV 345
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4W5Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4W5Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4W5Z)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:69 - Phe A:70   [ RasMol ]  
    Trp A:311 - Ser A:312   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4w5z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B1VBB0_MORMI | B1VBB0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.14
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B1VBB0_MORMI | B1VBB0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B1VBB0_MORMI | B1VBB0: 4hmc 4hmd 4hme 4mb3 4mb4 4mb5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4W5Z)