Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ZG3615, A FAMILY 117 GLYCOSIDE HYDROLASE IN COMPLEX WITH BETA-3,6-ANHYDRO-L-GALACTOSE
 
Authors :  E. Ficko-Blean
Date :  28 Jul 14  (Deposition) - 11 Feb 15  (Release) - 25 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gh117, Hydrolase, Bicyclic Sugar (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Ficko-Blean, D. Duffieux, E. Rebuffet, R. Larocque, A. Groisillier, G. Michel, M. Czjzek
Biochemical And Structural Investigation Of Two Paralogous Glycoside Hydrolases From Zobellia Galactanivorans: Novel Insights Into The Evolution, Dimerization Plasticity And Catalytic Mechanism Of The Gh117 Family.
Acta Crystallogr. , Sect. D V. 71 209 2015
PubMed-ID: 25664732  |  Reference-DOI: 10.1107/S1399004714025024

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PERIPLASMIC PROTEIN
    Chains: A, B
    EC Number: 3.2.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: ZOBELLIA_3615
    Organism Scientific: ZOBELLIA GALACTANIVORANS
    Organism Taxid: 63186
    Strain: DSM 12802 / CIP 106680 / NCIMB 13871 / DSIJ
    Synonym: GLYCOSIDE HYDROLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 28)

Asymmetric/Biological Unit (4, 28)
No.NameCountTypeFull Name
13DY1Ligand/Ion3,6-ANHYDRO-BETA-L-GALACTOPYRANOSE
2CA4Ligand/IonCALCIUM ION
3EDO22Ligand/Ion1,2-ETHANEDIOL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (28, 28)

Asymmetric Unit (28, 28)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:63 , ASP A:374 , SER A:376 , VAL A:379 , EDO A:509 , HOH A:684 , HOH A:953binding site for residue CA A 501
02AC2SOFTWAREHOH A:678 , HOH A:680 , HOH A:948 , HOH A:949 , HOH A:950 , HOH A:951 , HOH A:952binding site for residue CA A 502
03AC3SOFTWAREARG A:301 , ASN A:329 , PHE A:355 , THR A:356 , HOH A:921 , HOH A:955 , HOH A:961 , TYR B:390binding site for residue PEG A 503
04AC4SOFTWARETYR A:106 , ARG A:107 , ASN A:108 , LEU A:130 , GLU A:132 , HOH A:640binding site for residue EDO A 504
05AC5SOFTWARETYR A:100 , ASP A:140 , TRP A:350 , ARG A:370 , HOH A:958 , ILE B:409binding site for residue EDO A 505
06AC6SOFTWAREGLU A:146 , LYS A:175 , TYR A:177 , EDO A:512 , HOH A:606 , HOH A:628 , HOH A:777binding site for residue EDO A 506
07AC7SOFTWAREASN A:53 , ASN A:319 , ILE A:320 , HOH A:795 , HOH A:870 , HOH A:960 , HOH A:965binding site for residue EDO A 507
08AC8SOFTWARELYS A:238 , LYS A:343binding site for residue EDO A 508
09AC9SOFTWAREGLU A:60 , ASN A:61 , ASN A:62 , GLU A:63 , ASP A:374 , LYS A:385 , CA A:501 , HOH A:828binding site for residue EDO A 509
10AD1SOFTWAREARG A:408 , ILE A:409 , HOH A:1005binding site for residue EDO A 510
11AD2SOFTWARETHR A:342 , LYS A:343 , TYR A:344 , HOH A:872 , HOH A:977binding site for residue EDO A 511
12AD3SOFTWARETRP A:134 , GLY A:148 , TYR A:177 , PRO A:267 , EDO A:506 , HOH A:604 , HOH A:608 , HOH A:636binding site for residue EDO A 512
13AD4SOFTWARETRP A:172 , LYS A:173 , HOH A:726 , HOH A:797 , HOH A:966 , HOH A:1003binding site for residue EDO A 513
14AD5SOFTWAREPHE A:76 , ASP A:77 , TYR A:78 , GLY A:80 , HIS A:81 , HOH A:770 , HOH A:994binding site for residue EDO A 514
15AD6SOFTWAREASN A:97 , LYS A:99 , TYR A:101 , ASP A:205binding site for residue EDO A 515
16AD7SOFTWARELYS A:36 , TYR A:51 , MET A:55 , HOH A:717 , HOH A:967 , HOH A:1016binding site for residue EDO A 516
17AD8SOFTWARETHR A:137 , SER A:138 , LYS A:139 , GLU A:213 , HOH A:601 , HOH A:603 , HOH A:873binding site for residue EDO A 517
18AD9SOFTWARELYS A:156 , PRO A:157 , TRP A:161 , HOH A:886 , ASP B:252binding site for residue EDO A 518
19AE1SOFTWAREGLU A:325 , PHE A:326 , HOH A:1030 , GLU B:325 , PHE B:326binding site for residue EDO A 519
20AE2SOFTWARETYR A:70 , PHE A:326 , MET A:327 , PRO A:328 , ASN A:329 , PHE A:355 , HOH A:689 , HOH A:850 , HOH A:921 , TYR B:396binding site for residue EDO A 520
21AE3SOFTWAREARG A:88 , ASP A:89 , TRP A:128 , THR A:166 , GLN A:181 , ASP A:192 , ASP A:231 , LYS A:246 , GLU A:285 , HIS A:354 , HOH A:1004binding site for residue 3DY A 521
22AE4SOFTWAREHOH B:648 , HOH B:660 , HOH B:794 , HOH B:795 , HOH B:796 , HOH B:797 , HOH B:798binding site for residue CA B 501
23AE5SOFTWAREGLU B:63 , ASP B:374 , SER B:376 , VAL B:379 , HOH B:609 , HOH B:674 , HOH B:691binding site for residue CA B 502
24AE6SOFTWAREASN B:53 , TYR B:54 , MET B:55 , ASN B:319 , ILE B:320 , ALA B:321 , HOH B:809binding site for residue EDO B 503
25AE7SOFTWARELYS A:74 , PHE A:142 , HOH A:739 , HOH A:848 , ARG B:406binding site for residue EDO B 504
26AE8SOFTWARETHR B:166 , GLN B:181 , HOH B:684binding site for residue EDO B 505
27AE9SOFTWARESER B:274 , PRO B:275binding site for residue EDO B 506
28AF1SOFTWARELYS B:246 , HIS B:284 , GLU B:285 , HOH B:764 , HOH B:765binding site for residue EDO B 507

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4U6D)

(-) Cis Peptide Bonds  (10, 10)

Asymmetric/Biological Unit
No.Residues
1Lys A:156 -Pro A:157
2Gly A:206 -Pro A:207
3Asp A:252 -Pro A:253
4Gly A:269 -Pro A:270
5Asn A:277 -Pro A:278
6Lys B:156 -Pro B:157
7Gly B:206 -Pro B:207
8Asp B:252 -Pro B:253
9Gly B:269 -Pro B:270
10Asn B:277 -Pro B:278

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4U6D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4U6D)

(-) Exons   (0, 0)

(no "Exon" information available for 4U6D)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:382
                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhh....hhhhh......eeee.....hhhhh..eeee.....eee..eeeeeeeeee.......................eeeeeee.....eeeeeeee...........eeeeeeeeee..eeeeeeeee............eeeeee.......ee...................eeeeeeee..eeeeeeeeeee....eeeeeeeeee.......ee..............eeeee.eeeeee........eeeee.....eeeeee.....eeeee...........eeeeeeeeeee....hhhhh..eeeeeeeeee....hhhhh......hhhhhhh...hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4u6d A  28 EGFPFILPKEKPNRPLSAAMQRNYDNYMAPRPENNELYTQFKYTELKGFDYNGHDGTISRRDPSKVIYENGKYYVWYTYRNTPTPPQGAKNSNDTIPSADWDLAEIWYATSKDGFTWEEQGVAVPRPPKPNVGWRSVTTTDILKWKGKFYLYYQGFMEASGTRGDDCPVAVSYADSPDGPWTPHTEVVIPNGKKGEWDQYSIHDPYPIVYKDKIYLYYKSDFDGDPNLVRMQGLAIADNPLGPFKKSPLNPVINSGHETTLFPFKEGMAALVIRDGTEHNTVQYAEDGVNFNIASIVEFMPNAAGPYVADAFTNTKYGRGISWGISHFTNATTWDQNHAVLARFDCDLSLDVDDPHMKRLGTYFKPEFYYQMGLSKKQRERI 409
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407  


Chain B from PDB  Type:PROTEIN  Length:385
                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhh....hhhhh......eee......hhhhh..eeee.....eee..eeeeeeeeee......................eeeeeeee......eeeeeee...........eeeeeeeeee..eeeeeeeee............eeeeee.......ee...................eeeeeeee..eeeeeeeeeee....eeeeeeeeee.......ee..............eeeee.eeeeee........eeeee.....eeeeee.....eeeee...........eeeeeeeeeee....hhhhh..eeeeeeeeee....hhhhh......hhhhhhh...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4u6d B  26 QPEGFPFILPKEKPNRPLSAAMQRNYDNYMAPRPENNELYTQFKYTELKGFDYNGHDGTISRRDPSKVIYENGKYYVWYTYRNTPTPPQGAKNSNDTIPSADWDLAEIWYATSKDGFTWEEQGVAVPRPPKPNVGWRSVTTTDILKWKGKFYLYYQGFMEASGTRGDDCPVAVSYADSPDGPWTPHTEVVIPNGKKGEWDQYSIHDPYPIVYKDKIYLYYKSDFDGDPNLVRMQGLAIADNPLGPFKKSPLNPVINSGHETTLFPFKEGMAALVIRDGTEHNTVQYAEDGVNFNIASIVEFMPNAAGPYVADAFTNTKYGRGISWGISHFTNATTWDQNHAVLARFDCDLSLDVDDPHMKRLGTYFKPEFYYQMGLSKKQRERIE 410
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4U6D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4U6D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4U6D)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3DY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:277 - Pro A:278   [ RasMol ]  
    Asn B:277 - Pro B:278   [ RasMol ]  
    Asp A:252 - Pro A:253   [ RasMol ]  
    Asp B:252 - Pro B:253   [ RasMol ]  
    Gly A:206 - Pro A:207   [ RasMol ]  
    Gly A:269 - Pro A:270   [ RasMol ]  
    Gly B:206 - Pro B:207   [ RasMol ]  
    Gly B:269 - Pro B:270   [ RasMol ]  
    Lys A:156 - Pro A:157   [ RasMol ]  
    Lys B:156 - Pro B:157   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4u6d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F0V1E2_ZOBGA | F0V1E2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  F0V1E2_ZOBGA | F0V1E2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4U6D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4U6D)