Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HOMO SAPIENS IODOTYROSINE DEIODINASE BOUND TO FMN AND MONO-IODOTYROSINE (MIT)
 
Authors :  W. Chuenchor, J. Hu, S. Rokita
Date :  20 Jun 14  (Deposition) - 26 Nov 14  (Release) - 14 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Keywords :  Oxidoreductase, Flavoprotein, Membrane, Transmembrane, Dehalogenase, Iodide Salvage, Mono-Iodotyrosine, Mit (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Hu, W. Chuenchor, S. E. Rokita
A Switch Between One- And Two-Electron Chemistry Of The Human Flavoprotein Iodotyrosine Deiodinase Is Controlled By Substrate.
J. Biol. Chem. V. 290 590 2015
PubMed-ID: 25395621  |  Reference-DOI: 10.1074/JBC.M114.605964

(-) Compounds

Molecule 1 - IODOTYROSINE DEHALOGENASE 1
    Chains: A, B, C, D, E, F
    EC Number: 1.22.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28-SUMO
    Expression System Strain: ROSETTA 2(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 32-289
    Gene: IYD, C6ORF71, DEHAL1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IYD-1

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): AB    
Biological Unit 2 (1x):   CD  
Biological Unit 3 (1x):     EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 12)

Asymmetric Unit (2, 12)
No.NameCountTypeFull Name
1FMN6Ligand/IonFLAVIN MONONUCLEOTIDE
2IYR6Ligand/Ion3-IODO-TYROSINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2IYR2Ligand/Ion3-IODO-TYROSINE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2IYR2Ligand/Ion3-IODO-TYROSINE
Biological Unit 3 (2, 4)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2IYR2Ligand/Ion3-IODO-TYROSINE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:100 , ARG A:101 , SER A:102 , ARG A:104 , LEU A:176 , THR A:178 , THR A:237 , THR A:238 , THR A:239 , ARG A:279 , IYR A:302 , HOH A:425 , HOH A:426 , HOH A:427 , PRO B:127 , SER B:128 , GLY B:129 , HIS B:131 , TYR B:212 , ILE B:215 , SER B:216binding site for residue FMN A 301
02AC2SOFTWAREGLU A:157 , TYR A:161 , LEU A:173 , LEU A:176 , THR A:178 , ASN A:179 , LYS A:182 , FMN A:301 , HOH A:437 , ALA B:130binding site for residue IYR A 302
03AC3SOFTWAREPRO A:127 , SER A:128 , GLY A:129 , TYR A:212 , SER A:216 , ARG B:100 , ARG B:101 , SER B:102 , ARG B:104 , LEU B:176 , VAL B:236 , THR B:237 , THR B:238 , THR B:239 , LEU B:277 , ARG B:279 , IYR B:302 , HOH B:404 , HOH B:413 , HOH B:424binding site for residue FMN B 301
04AC4SOFTWAREALA A:130 , GLU B:157 , TYR B:161 , LEU B:173 , LEU B:176 , THR B:178 , ASN B:179 , LYS B:182 , FMN B:301 , HOH B:435binding site for residue IYR B 302
05AC5SOFTWAREARG C:100 , ARG C:101 , SER C:102 , ARG C:104 , LEU C:176 , THR C:178 , VAL C:236 , THR C:237 , THR C:238 , THR C:239 , ARG C:279 , IYR C:302 , HOH C:409 , HOH C:411 , HOH C:415 , HOH C:416 , PRO D:127 , SER D:128 , GLY D:129 , TYR D:212 , SER D:216binding site for residue FMN C 301
06AC6SOFTWAREGLU C:157 , TYR C:161 , TRP C:169 , LEU C:173 , LEU C:176 , THR C:178 , LYS C:182 , FMN C:301 , ALA D:130 , TYR D:211binding site for residue IYR C 302
07AC7SOFTWAREPRO C:127 , SER C:128 , GLY C:129 , HIS C:131 , TYR C:212 , SER C:216 , ARG D:100 , ARG D:101 , SER D:102 , ARG D:104 , LEU D:176 , VAL D:236 , THR D:237 , THR D:238 , THR D:239 , ARG D:279 , IYR D:302 , HOH D:410 , HOH D:416binding site for residue FMN D 301
08AC8SOFTWAREALA C:130 , GLU D:157 , TYR D:161 , LEU D:173 , LEU D:176 , ASN D:179 , LYS D:182 , THR D:239 , FMN D:301 , HOH D:412binding site for residue IYR D 302
09AC9SOFTWAREARG E:100 , ARG E:101 , SER E:102 , ARG E:104 , LEU E:176 , THR E:178 , VAL E:236 , THR E:237 , THR E:238 , THR E:239 , ARG E:279 , IYR E:302 , HOH E:406 , HOH E:410 , HOH E:420 , PRO F:127 , SER F:128 , GLY F:129 , HIS F:131 , TYR F:212 , SER F:216 , HOH F:405binding site for residue FMN E 301
10AD1SOFTWAREGLU E:157 , TYR E:161 , LEU E:173 , LEU E:176 , THR E:178 , ASN E:179 , LYS E:182 , THR E:239 , FMN E:301 , ALA F:130binding site for residue IYR E 302
11AD2SOFTWAREPRO E:127 , SER E:128 , GLY E:129 , TYR E:212 , ILE E:215 , SER E:216 , ARG F:100 , ARG F:101 , SER F:102 , ARG F:104 , LEU F:176 , THR F:178 , VAL F:236 , THR F:237 , THR F:238 , THR F:239 , ARG F:279 , IYR F:302 , HOH F:404 , HOH F:406 , HOH F:409binding site for residue FMN F 301
12AD3SOFTWAREALA E:130 , GLU F:157 , TYR F:161 , LEU F:173 , LEU F:176 , THR F:178 , ASN F:179 , LYS F:182 , FMN F:301binding site for residue IYR F 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TTC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TTC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TTC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TTC)

(-) Exons   (0, 0)

(no "Exon" information available for 4TTC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.eee..hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc A  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290


Chain B from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc B  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290


Chain C from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh..........eeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc C  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290


Chain D from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.eee..hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc D  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290


Chain E from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc E  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290


Chain F from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh..........eeeeee.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhh.eeeeeeee.eee.....eee..hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.....eeeeeeeee.......eee.....hhhh.eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ttc F  71 VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTVH 290
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TTC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TTC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TTC)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IYR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ttc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ttc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IYD1_HUMAN | Q6PHW0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.22.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IYD1_HUMAN | Q6PHW0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IYD1_HUMAN | Q6PHW0: 4ttb

(-) Related Entries Specified in the PDB File

4ttb