Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MEGAVIRUS UDP-GLCNAC 4,6-DEHYDRATASE, 5-EPIMERASE MG534
 
Authors :  S. Jeudy, F. Piacente, C. De Castro, A. Molinaro, A. Salis, G. Damonte, C. Bernardi, M. Tonetti, J. M. Claverie, C. Abergel
Date :  11 Jun 14  (Deposition) - 25 Jun 14  (Release) - 17 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Nadp Binding Sugar Pathway, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Piacente, C. De Castro, S. Jeudy, A. Molinaro, A. Salis, G. Damonte C. Bernardi, C. Abergel, M. G. Tonetti
Giant Virus Megavirus Chilensis Encodes The Biosynthetic Pathway For Uncommon Acetamido Sugars.
J. Biol. Chem. V. 289 24428 2014
PubMed-ID: 25035429  |  Reference-DOI: 10.1074/JBC.M114.588947

(-) Compounds

Molecule 1 - PUTATIVE DTDP-D-GLUCOSE 4 6-DEHYDRATASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: MG534
    Organism Scientific: MEGAVIRUS CHILIENSIS
    Organism Taxid: 1094892

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1NDP1Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:12 , SER A:14 , GLY A:15 , SER A:16 , LEU A:17 , SER A:35 , ARG A:36 , ASP A:37 , LYS A:40 , GLY A:58 , ASP A:59 , ILE A:60 , ALA A:81 , ALA A:82 , ALA A:83 , LYS A:85 , THR A:100 , VAL A:128 , SER A:129 , TYR A:140 , LYS A:144 , TYR A:168 , GLY A:169 , ASN A:170 , VAL A:171 , HOH A:560 , HOH A:587binding site for residue NDP A 400

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:90 -A:97

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TQG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TQG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TQG)

(-) Exons   (0, 0)

(no "Exon" information available for 4TQG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:297
                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee...hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee.hhh...hhhhhhhhhhhhhhhhhhhhh...eeeeeee......ee.....eee..hhhhhhhhhhhhhhhh....eeee...eeehhhhhhhhhhhh..ee...........eeehhhhhh.eeee..eeee...............ee......hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tqg A   1 SQINDKTIMIFGGSGSLGNRLIETYINNNIIVNYSRDESKHWSMELKYKSDKLKNIIGDIRDFEKVQQSIMRINPDIIIIAAALKHIDRCEYEINECLDTNIKGLQNVLKVTEINRSNLSNLKAVCFVSTDKACSPVNSYGMSKAICETLVVEKSKYIKDIKYVCVRYGNVLNFTLTHTSMTRFIMTLDDSVKLIEYAIINGNSGEIVIPKLNSMYIKDMIELFADKYPIVITGLRSGERMYESLINDTQSMKTVPKGDYYHILPTYDPTIVTEEFYEYSSKQNILSKQELENYLNQ 319
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  ||   200       210       220       230       240       252       262       272       282       292       302       312       
                                                                                                                                                                                                      173|                                                   248|                                                                    
                                                                                                                                                                                                       194                                                    251
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TQG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TQG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TQG)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tqg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tqg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G5CSR9_9VIRU | G5CSR9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G5CSR9_9VIRU | G5CSR9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4TQG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TQG)