Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN LIMK2 KINASE DOMAIN IN COMPLEX WITH A NON-ATP COMPETITIVE INHIBITOR
 
Authors :  N. C. Goodwin, G. Cianchetta, B. L. Hamman, H. A. Burgoon, J. Healy, S. Ma E. D. Strobel, S. Wang, D. B. Rawlins
Date :  09 Jun 14  (Deposition) - 22 Oct 14  (Release) - 28 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Limk2 Kinase, Dfg Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. C. Goodwin, G. Cianchetta, H. A. Burgoon, J. Healy, R. Mabon, E. D. Strobel, J. Allen, S. Wang, B. D. Hamman, D. B. Rawlins
Discovery Of A Type Iii Inhibitor Of Lim Kinase 2 That Bind In A Dfg-Out Conformation.
Acs Med. Chem. Lett. V. 6 53 2015
PubMed-ID: 25589930  |  Reference-DOI: 10.1021/ML500242Y

(-) Compounds

Molecule 1 - LIM DOMAIN KINASE 2
    ChainsA, B
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemUNIDENTIFIED BACULOVIRUS
    Expression System Taxid10469
    FragmentKINASE DOMAIN (UNP RESIDUES 330-632)
    GeneLIMK2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLIMK-2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
135H2Ligand/IonN-{4-[(1S)-1,2-DIHYDROXYETHYL]BENZYL}-N-METHYL-4-(PHENYLSULFAMOYL)BENZAMIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:361 , ILE A:363 , MET A:380 , LEU A:383 , VAL A:388 , LEU A:389 , PHE A:391 , THR A:405 , VAL A:467 , ALA A:468 , ASP A:469 , PHE A:470 , LEU A:472 , ARG A:474binding site for residue 35H A 701
2AC2SOFTWARELYS B:360 , GLU B:361 , LEU B:362 , ILE B:363 , MET B:380 , LEU B:383 , VAL B:388 , LEU B:389 , PHE B:391 , THR B:405 , HIS B:449 , VAL B:467 , ASP B:469 , PHE B:470 , LEU B:472 , ARG B:474binding site for residue 35H B 701

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:365 -B:549
2A:549 -B:365

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TPT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TPT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TPT)

(-) Exons   (0, 0)

(no "Exon" information available for 4TPT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:279
                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.......eeeeee.....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee....eeeeee...eeehhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee........eeee....eee.......ee..............hhhhhh......hhhhhhhhhhhhhhhhh................hhhhhhhhhh......hhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tpt A 330 DLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYG 631
                                   339       349       359       369       379       389       399       409       419       429       439       449       459       469       502       512       522       532       542       552       562       572       582       592       602       612       622         
                                                                                                                                                                             477|                                                                                                                                  
                                                                                                                                                                              501                                                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.......eeeeee.....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee....eeeeee...eeehhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee........eeee....eee.......ee...........hhhhhh.....hhhhhhhhhhhhhhhhhh................hhhhhhhhhh......hhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tpt B 330 DLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGL 632
                                   339       349       359       369       379       389       399       409       419       429       439       449       459       469       505       515       525       535       545       555       565       575       585       595       605       615       625       
                                                                                                                                                                             477|                                                                                                                                
                                                                                                                                                                              504                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TPT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TPT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TPT)

(-) Gene Ontology  (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    35H  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tpt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tpt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LIMK2_HUMAN | P53671
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LIMK2_HUMAN | P53671
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LIMK2_HUMAN | P536711x6a 5nxd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TPT)