Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SEC14-LIKE PROTEIN 4 (SEC14L4)
 
Authors :  M. Vollmar, J. Kopec, W. Kiyani, L. Shrestha, F. Sorrell, T. Krojer, E. W N. Burgess-Brown, F. Von Delft, C. Arrowsmith, A. Edwards, C. Bountr
Date :  29 May 14  (Deposition) - 02 Jul 14  (Release) - 30 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.77
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Sec14L4, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Vollmar
Crystal Structure Of Sec14-Like Protein 4 (Sec14L4)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SEC14-LIKE PROTEIN 4
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC28BSA
    Expression System Taxid: 469008
    Expression System Variant: ROSETTA
    Gene: SEC14L4, TAP3
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: TOCOPHEROL-ASSOCIATED PROTEIN 3

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 28)

Asymmetric Unit (2, 28)
No.NameCountTypeFull Name
111A2Ligand/IonUNDECANOIC ACID
2EDO26Ligand/Ion1,2-ETHANEDIOL
Biological Unit 1 (2, 18)
No.NameCountTypeFull Name
111A1Ligand/IonUNDECANOIC ACID
2EDO17Ligand/Ion1,2-ETHANEDIOL
Biological Unit 2 (2, 10)
No.NameCountTypeFull Name
111A1Ligand/IonUNDECANOIC ACID
2EDO9Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (28, 28)

Asymmetric Unit (28, 28)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:179 , TYR A:182 , PRO A:183 , GLU A:184 , THR A:185 , LEU A:186 , THR A:213 , HOH A:708binding site for residue EDO A 501
02AC2SOFTWAREPHE A:37 , ARG A:40 , TRP A:41 , HIS A:59 , LEU A:132 , ASN A:181 , TYR A:182 , HOH A:854binding site for residue EDO A 502
03AC3SOFTWARELEU A:160 , LEU A:163 , GLY A:351 , SER A:352 , HOH A:727 , HOH A:731binding site for residue EDO A 503
04AC4SOFTWARETRP A:305 , TYR A:342 , GLU A:349 , ASP A:350 , HOH A:806binding site for residue EDO A 504
05AC5SOFTWARELYS A:266 , TYR A:269 , CYS A:271 , GLU A:272 , HOH A:611binding site for residue EDO A 505
06AC6SOFTWAREGLY A:221 , ASP A:222 , ASN A:223 , GLU A:227 , MET A:397binding site for residue EDO A 506
07AC7SOFTWARELYS A:266 , SER A:267 , HOH A:602 , HOH A:611 , HOH A:855binding site for residue EDO A 507
08AC8SOFTWAREASN A:32 , ASP A:34 , GLU A:136 , LYS A:145binding site for residue EDO A 508
09AC9SOFTWARELEU A:106 , ASP A:107 , PRO A:108 , LYS A:109 , LYS A:161 , HIS A:162binding site for residue EDO A 509
10AD1SOFTWARESER A:339 , ASP A:366 , HOH A:865binding site for residue EDO A 510
11AD2SOFTWARELYS A:165 , PRO A:166 , GLU A:169 , GLN A:277 , GLN A:306 , HOH A:755binding site for residue EDO A 511
12AD3SOFTWAREPRO A:299 , PRO A:386 , GLU A:391 , HOH A:721binding site for residue EDO A 512
13AD4SOFTWARECYS A:128 , THR A:185 , LEU A:186binding site for residue EDO A 513
14AD5SOFTWAREGLU A:263 , PRO A:265 , HOH A:827binding site for residue EDO A 514
15AD6SOFTWAREMET A:245 , THR A:246 , ASP A:247 , THR A:256 , LYS A:257binding site for residue EDO A 517
16AD7SOFTWAREPRO A:108 , HIS A:162 , TYR A:171binding site for residue 11A A 518
17AD8SOFTWAREGLU B:179 , TYR B:182 , PRO B:183 , GLU B:184 , THR B:185 , LEU B:186 , THR B:213 , HOH B:662binding site for residue EDO B 501
18AD9SOFTWAREGLY B:351 , SER B:352binding site for residue EDO B 502
19AE1SOFTWARETRP B:305 , GLU B:349 , ASP B:350binding site for residue EDO B 503
20AE2SOFTWARELEU B:130 , HOH B:678 , HOH B:729binding site for residue EDO B 504
21AE3SOFTWARECYS B:128 , LEU B:132 , LEU B:178 , THR B:185binding site for residue EDO B 505
22AE4SOFTWARELYS B:230binding site for residue EDO B 506
23AE5SOFTWARETYR B:93 , GLU B:94binding site for residue EDO B 507
24AE6SOFTWAREARG B:40 , HIS B:59 , ASN B:181 , TYR B:182binding site for residue EDO B 508
25AE7SOFTWAREGLU B:78binding site for residue EDO B 509
26AE8SOFTWAREPRO B:108 , HIS B:162 , TYR B:171binding site for residue 11A B 510
27AE9SOFTWAREILE A:29 , MET A:60 , HOH A:627binding site for residues EDO A 515 and EDO A 516
28AF1SOFTWAREILE A:29 , MET A:60 , HOH A:627binding site for residues EDO A 515 and EDO A 516

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TLG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TLG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TLG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TLG)

(-) Exons   (0, 0)

(no "Exon" information available for 4TLG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:396
                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh..hhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..eeeee.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhheee...hhhhhhh...hhhhhhhhhh......................hhhhh..........eeeee....eeeeeeee.....eeeeeeeee...eeeeeee.............eeeeeeeee......eeeeee....eeeeeeee........eeeeeeeeee..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tlg A   3 SRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSMR 398
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392      


Chain B from PDB  Type:PROTEIN  Length:388
                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..eeeee.....eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhheee...hhhhhhh...hhhhhhhhhh......................hhhhh..........eeeee....eeeeeeee.....eeeeeeeee...eeeeeee.............eeeeeeeee......eeeeee....eeeeeeee.......eeeeeeeeee..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tlg B   7 DLSPQQQEALARFRENLQDLLPILADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMAKKLSYTVEVLLPDKASEETLQSM 397
                                    16        26   ||   38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368   ||  379       389        
                                                  30|                                                                                                                                                                                                                                                                                                                                                372|                       
                                                   33                                                                                                                                                                                                                                                                                                                                                 374
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TLG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TLG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TLG)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    11A  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tlg)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tlg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S14L4_HUMAN | Q9UDX3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  S14L4_HUMAN | Q9UDX3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4TLG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TLG)