Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM PUTATIVE HISTONE METHYLTRANSFERASE PFL0690C
 
Authors :  D. Q. Jiang, W. Tempel, P. Loppnau, S. Graslund, H. He, M. Ravichandran, A. Seitova, C. H. Arrowsmith, A. M. Edwards, C. Bountra, R. Hui, A. Hutc Y. H. Lin, Structural Genomics Consortium (Sgc)
Date :  17 Dec 14  (Deposition) - 21 Jan 15  (Release) - 21 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.49
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics Consortium, Sgc, Putative Histone Methyltransferase, Pfl0690C, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Q. Jiang, W. Tempel, P. Loppnau, S. Graslund, H. He, M. Ravichandran A. Seitova, C. H. Arrowsmith, A. M. Edwards, C. Bountra, R. Hui, A. Hutchinson, Y. H. Lin
Crystal Structure Of Plasmodium Falciparum Putative Histone Methyltransferase Pfl0690C
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PFL0690C
    ChainsA, B
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidPFBOH-MHL
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypePLASMID
    GenePFAG_03779, PFL0690C
    Organism ScientificPLASMODIUM
    Organism Taxid418107
    StrainLAVERANIA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1UNX7Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (0, 0)

(no "Site" information available for 4RZ0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4RZ0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4RZ0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4RZ0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4RZ0)

(-) Exons   (0, 0)

(no "Exon" information available for 4RZ0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.....eeeee........eeeeeeeeeee.hhhhhhhhhhh.....eeeee.......ee.....eeeeeee...eeeeeeeeee..........ee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 4rz0 A   3 IQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGKNYKLLPLGYGILYNHSDIPNAYVEIHKINTVSNNVMIVYAYNNIQKDDEILISYGHSWWK 146
                                    12        22        32        42        52   ||   82        92       102  ||   122       132       142    
                                                                                56|                         105|                              
                                                                                 77                          116                              

Chain B from PDB  Type:PROTEIN  Length:110
                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeee........eeeeeeeeeee.hhhhhhhhhhh....eeeee.......ee.....eeeeeee.....eeeeeeeeee..........ee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 4rz0 B   6 KIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGNYKLLPLGYGILYNHSDIPNAYVEIHKINKVTVSNNVMIVYAYNNIQKDDEILISYGHSW 144
                                    15        25        35        45        55|       86        96       106|      124       134       144
                                                                            55|                          106|                             
                                                                             77                           115                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4RZ0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4RZ0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4RZ0)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4RZ0)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 4rz0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4rz0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4rz0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  W7FLI1_PLAFA | W7FLI1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  W7FLI1_PLAFA | W7FLI1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4RZ0)

(-) Related Entries Specified in the PDB File

4rz7