Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF L. MONOCYTOGENES PSTA IN COMPLEX WITH CYCLIC-DI-AMP
 
Authors :  P. H. Choi, L. Tong
Date :  07 Dec 14  (Deposition) - 17 Dec 14  (Release) - 01 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Pii-Like, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. H. Choi, K. Sureka, J. J. Woodward, L. Tong
Molecular Basis For The Recognition Of Cyclic-Di-Amp By Psta, A Pii -Like Signal Transduction Protein.
Microbiologyopen V. 4 361 2015
PubMed-ID: 25693966  |  Reference-DOI: 10.1002/MBO3.243

(-) Compounds

Molecule 1 - LMO2692 PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: LMO2692
    Organism Scientific: LISTERIA MONOCYTOGENES
    Organism Taxid: 169963
    Strain: ATCC BAA-679 / EGD-E

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
12BA4Ligand/Ion(2R,3R,3AS,5R,7AR,9R,10R,10AS,12R,14AR)-2,9-BIS(6-AMINO-9H-PURIN-9-YL)OCTAHYDRO-2H,7H-DIFURO[3,2-D:3',2'-J][1,3,7,9,2,8]TETRAOXADIPHOSPHACYCLODODECINE-3,5,10,12-TETROL 5,12-DIOXIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:7 , GLY A:34 , GLY A:35 , PHE A:36 , LEU A:37 , ASN A:41 , VAL A:91 , GLN A:92 , GLY A:94 , THR A:97 , HOH A:2114 , HOH A:2115 , HOH A:2116 , HOH A:2117 , HOH A:2118 , HOH A:2120 , HOH A:2176 , HOH A:2177 , GLY B:26 , ALA B:27 , THR B:28 , ILE B:45 , GLY B:47 , VAL B:81 , HIS B:108 , HOH B:2142 , MET C:70 , VAL C:85 , TYR C:87 , PRO C:88BINDING SITE FOR RESIDUE 2BA A 2001
2AC2SOFTWAREMET A:1 , GLU A:49 , ASP A:50 , GLU A:51 , ARG A:52 , SER A:74 , SER A:76 , LEU A:77 , GLY A:78 , ASP A:82 , TYR A:84 , HOH A:2104 , HOH A:2109 , HOH A:2110 , HOH A:2111 , HOH A:2146 , HOH A:2158 , GLU B:68 , HOH B:2180BINDING SITE FOR RESIDUE 2BA A 2002
3AC3SOFTWAREVAL A:85 , PRO A:86 , TYR A:87 , ILE B:7 , GLY B:34 , GLY B:35 , PHE B:36 , LEU B:37 , ASN B:41 , VAL B:91 , GLN B:92 , VAL B:93 , GLY B:94 , THR B:97 , HOH B:2110 , HOH B:2111 , HOH B:2112 , HOH B:2118 , HOH B:2121 , HOH B:2122 , HOH B:2140 , HOH B:2190 , HOH B:2196 , GLY C:26 , ALA C:27 , THR C:28 , ILE C:45 , GLY C:47 , HIS C:108 , HOH C:2150BINDING SITE FOR RESIDUE 2BA B 2001
4AC4SOFTWAREASN A:24 , GLY A:26 , ALA A:27 , THR A:28 , ILE A:45 , GLY A:47 , VAL A:79 , HIS A:108 , HOH A:2131 , PRO B:88 , HOH B:2135 , ILE C:7 , GLY C:34 , GLY C:35 , PHE C:36 , LEU C:37 , ASN C:41 , GLN C:92 , GLY C:94 , THR C:97 , HOH C:2105 , HOH C:2106 , HOH C:2107 , HOH C:2116 , HOH C:2119 , HOH C:2120 , HOH C:2121BINDING SITE FOR RESIDUE 2BA C 2001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4RWW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4RWW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4RWW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4RWW)

(-) Exons   (0, 0)

(no "Exon" information available for 4RWW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:113
                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhhh...eeeeeeee....eeeeeeeeee.hhhhhhhhhhhhhh...eeeee.................eeeee..eeeeee...eeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 4rww A   1 MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEHH 113
                                    10        20        30        40        50        60        70        80        90       100       110   


Chain B from PDB  Type:PROTEIN  Length:106
                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhhh...eeeeeeee....eeeeeeeeee.hhhhhhhhhhhhhh...eeeee...........eeeee..eeeeee...eeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 4rww B   1 MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEH 112
                                    10        20        30        40        50        60        70  ||    86        96       106      
                                                                                                   73|                                
                                                                                                    80                                


Chain C from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhhhhhh...eeeeeeee....eeeeeeeeee.hhhhhhhhhhhhhh...eeeee........eeeee..eeeeee...eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 4rww C   1 MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPTYVPYPIEVQVGGATVFVMPVESFHHFLEH 112
                                    10        20        30        40        50        60        70  ||    89        99       109   
                                                                                                   73|                             
                                                                                                    83
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4RWW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4RWW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4RWW)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4RWW)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2BA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4rww)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4rww
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8Y3Y7_LISMO | Q8Y3Y7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8Y3Y7_LISMO | Q8Y3Y7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8Y3Y7_LISMO | Q8Y3Y7: 4rwx

(-) Related Entries Specified in the PDB File

4rwx