Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  METHYLTRANSFERASE DOMAIN OF C9ORF114
 
Authors :  A. Dong, H. Zeng, J. R. Walker, Y. Li, C. Bountra, C. H. Arrowsmith, A. M. E P. J. Brown, H. Wu, Structural Genomics Consortium (Sgc)
Date :  29 Sep 14  (Deposition) - 15 Oct 14  (Release) - 15 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.86
Chains :  Asym./Biol. Unit :  A,B
Keywords :  C9Orf114, Methyltransferase, Sah, Structural Genomics, Structural Genomics Consortium, Sgc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Zeng, A. Dong, J. R. Walker, Y. Li, C. Bountra, C. H. Arrowsmith, A. M. Edwards, P. J. Brown, H. Wu
The Crystal Structure Of Human C9Orf114 In Complex With S-Adenosyl-Homocysteine
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - C9ORF114
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28-MHL
    Expression System Strain: BL21(DE3) CODON PLUS RIL
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: METHYLTRANSFERASE DOMAIN (UNP RESIDUES 64-376)
    Gene: C9ORF114
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 9)

Asymmetric/Biological Unit (4, 9)
No.NameCountTypeFull Name
115P4Ligand/IonPOLYETHYLENE GLYCOL (N=34)
2PGO1Ligand/IonS-1,2-PROPANEDIOL
3SAH2Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
4UNX2Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:289 , SER A:290 , GLU A:291 , ARG A:292 , PHE A:311 , GLY A:312 , GLY A:313 , LEU A:314 , GLY A:316 , VAL A:340 , ASN A:341 , THR A:342 , GLN A:346 , THR A:350 , ILE A:351 , THR A:353 , ALA A:356 , HOH A:516 , HOH A:534 , HOH A:545 , HOH A:585 , HOH A:682 , HOH A:706 , HOH A:742BINDING SITE FOR RESIDUE SAH A 401
2AC2SOFTWAREGLN A:147 , GLU A:150 , TYR A:262 , THR A:263 , VAL A:264 , 15P A:403 , HOH A:505BINDING SITE FOR RESIDUE 15P A 402
3AC3SOFTWAREASP A:110 , GLU A:191 , SER A:249 , GLN A:250 , TRP A:260 , GLY A:261 , THR A:263 , 15P A:402 , HOH A:663 , HOH A:723BINDING SITE FOR RESIDUE 15P A 403
4AC4SOFTWARETHR B:289 , SER B:290 , GLU B:291 , ARG B:292 , PHE B:311 , GLY B:312 , GLY B:313 , LEU B:314 , GLY B:316 , VAL B:340 , ASN B:341 , THR B:342 , GLN B:346 , ILE B:351 , THR B:353 , ALA B:356 , HOH B:577 , HOH B:578 , HOH B:587 , HOH B:645 , HOH B:791BINDING SITE FOR RESIDUE SAH B 401
5AC5SOFTWARETYR B:95 , GLY B:98 , GLN B:99 , ARG B:102 , LEU B:172 , ASN B:173 , HOH B:817BINDING SITE FOR RESIDUE PGO B 402
6AC6SOFTWAREASP B:110 , SER B:249 , GLN B:250 , TRP B:260 , THR B:263 , 15P B:404 , HOH B:768BINDING SITE FOR RESIDUE 15P B 403
7AC7SOFTWAREVAL B:140 , GLN B:147 , GLU B:150 , ARG B:226 , THR B:263 , VAL B:264 , 15P B:403 , HOH B:525 , HOH B:767BINDING SITE FOR RESIDUE 15P B 404

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4RG1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4RG1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4RG1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4RG1)

(-) Exons   (0, 0)

(no "Exon" information available for 4RG1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:285
                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee.hhhhhh.hhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhh...............eeeeee..........eeee......eee........eeeeee........eeeeee..hhhhhhhh.....eeeee.hhhhhhhh........eeeee....ee.hhh......eeeee......hhhhhhhh......hhhhhh.eeee..........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4rg1 A  69 RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR 374
                                    78        88        98       108       118|      145       155       167       177       187       197       207       217       227       239       249       259       269       279       289       299       309       319       329       339       349       359       369     
                                                                           118|                        163|                                                                  235|                                                                                                                                        
                                                                            136                         166                                                                   238                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:282
                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeeee.hhhhhh.hhhhhhhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh................eeeeeee.........eeee......eee........eeeeee....eeee..hhhhhhhh.....eeeee.hhhhhhhh........eeeee....ee.hhh......eeeee......hhhhhhhh......hhhhhh.eeee..........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4rg1 B  69 RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR 374
                                    78        88        98       108       118||     144       154       164       174       184       194       204       214       224       242       252       262       272       282       292       302       312       322       332       342       352       362       372  
                                                                            119|                                                                                              233|                                                                                                                                    
                                                                             136                                                                                               242
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4RG1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4RG1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4RG1)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    15P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PGO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4rg1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4rg1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CI114_HUMAN | Q5T280
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CI114_HUMAN | Q5T280
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4RG1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4RG1)