Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HOMOSERINE O-ACETYLTRANSFERASE FROM STAPHYLOCOCCUS AUREUS
 
Authors :  B. Thangavelu, A. G. Pavlovsky, R. E. Viola
Date :  12 Jun 14  (Deposition) - 20 Aug 14  (Release) - 17 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Rossmann Fold, Acetyltransferase, Acetylco-A Binding, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Thangavelu, A. G. Pavlovsky, R. Viola
Structure Of Homoserine O-Acetyltransferase From Staphylococcus Aureus: The First Gram-Positive Ortholog Structure.
Acta Crystallogr. , Sect. F V. 70 1340 2014
PubMed-ID: 25286936  |  Reference-DOI: 10.1107/S2053230X14018664

(-) Compounds

Molecule 1 - HOMOSERINE O-ACETYLTRANSFERASE
    ChainsA
    EC Number2.3.1.31
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPDEST42
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneAZ30_00060, METX, SACOL0012, USA300HOU_0012
    Organism ScientificSTAPHYLOCOCCUS AUREUS SUBSP. AUREUS
    Organism Taxid451516
    StrainTCH1516

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4QLO)

(-) Sites  (0, 0)

(no "Site" information available for 4QLO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4QLO)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:130 -Ser A:131
2Tyr A:328 -Lys A:329

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4QLO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4QLO)

(-) Exons   (0, 0)

(no "Exon" information available for 4QLO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:327
                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...ee.....ee...eeeeeee......eeeee..................hhhhhhh........eeeee......................hhhhhhhhhhhhhhhh...eeeeeeeehhhhhhhhhhhhhh..eeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhh...eeeeeee......hhhhhhhhhh...eeeeeee....hhhhh..hhhhhhhhhhhhhh.......hhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4qlo A   3 NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK 329
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4QLO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4QLO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4QLO)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4QLO)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4qlo)
 
  Sites
(no "Sites" information available for 4qlo)
 
  Cis Peptide Bonds
    Gly A:130 - Ser A:131   [ RasMol ]  
    Tyr A:328 - Lys A:329   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4qlo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.31
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4QLO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4QLO)