Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE CYTOMEGALOVIRUS-ENCODED M04 GLYCOPROTEIN
 
Authors :  R. Berry, J. Rossjohn
Date :  23 May 14  (Deposition) - 23 Jul 14  (Release) - 01 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Berry, J. P. Vivian, F. A. Deuss, G. R. Balaji, P. M. Saunders, J. Lin, D. R. Littler, A. G. Brooks, J. Rossjohn
The Structure Of The Cytomegalovirus-Encoded M04 Glycoprotein, A Prototypical Member Of The M02 Family Of Immunoevasins.
J. Biol. Chem. V. 289 23753 2014
PubMed-ID: 24982419  |  Reference-DOI: 10.1074/JBC.M114.584128

(-) Compounds

Molecule 1 - M04
    Chains: A, B
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK
    Expression System Taxid: 9606
    Fragment: UNP RESIDUES 24-224
    Gene: M04
    Organism Scientific: MUROMEGALOVIRUS G4
    Organism Taxid: 524650

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 13)

Asymmetric/Biological Unit (2, 13)
No.NameCountTypeFull Name
1MAN2Ligand/IonALPHA-D-MANNOSE
2NAG11Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:54 , TRP A:148 , THR A:149 , SER A:150binding site for Poly-Saccharide residues NAG A 301 through MAN A 303 bound to ASN A 54
2AC2SOFTWAREALA A:89 , ASN A:115binding site for Poly-Saccharide residues NAG A 304 through NAG A 305 bound to ASN A 115
3AC3SOFTWAREVAL A:107 , LYS A:108 , GLN A:112 , TYR A:128 , ASN A:130binding site for Poly-Saccharide residues NAG A 306 through NAG A 307 bound to ASN A 130
4AC4SOFTWAREASN B:54 , TRP B:148 , SER B:150binding site for Poly-Saccharide residues NAG B 1000 through MAN B 1002 bound to ASN B 54
5AC5SOFTWAREALA B:89 , ASN B:115binding site for Mono-Saccharide NAG B 1003 bound to ASN B 115
6AC6SOFTWAREVAL B:107 , LYS B:108 , TYR B:128 , ASN B:130binding site for Poly-Saccharide residues NAG B 1004 through NAG B 1005 bound to ASN B 130

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:25 -A:146
2A:46 -A:141
3B:25 -B:146
4B:46 -B:141

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:122 -Gly A:123
2Thr A:133 -Gly A:134
3Asp B:118 -Asn B:119
4Gly B:122 -Gly B:123

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PN6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PN6)

(-) Exons   (0, 0)

(no "Exon" information available for 4PN6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:167
                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee...eeeee..eee......eeee.........eeeeeeeee....ee..eeeeeeee..eeeeeeeeee..............hhhh.eee...........eee.......hhh.eeeeeeeeeee........hhhhhhhhhhhhh........ee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pn6 A  19 YRHPLGCYFKGINPTKVPSSGSHTILKCTLPVVKVNASWTLEWVVVKLQNSVDVTSYYESSPNSGPTFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRD 185
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       


Chain B from PDB  Type:PROTEIN  Length:168
                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eeeeee..eee......eeee.........eeeeeeeee....ee..eeeeeeee..eeeeeeeeee..............hhhh.eee...........eee...........eeeeeeeeeee........hhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4pn6 B  19 YRHPLGCYFKGINPTKVPSSGSHTILKCTLPVVKVNASWTLEWVVVKLQNSVDVTSYYESSPNSGPTFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRDE 186
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PN6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PN6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PN6)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp B:118 - Asn B:119   [ RasMol ]  
    Gly A:122 - Gly A:123   [ RasMol ]  
    Gly B:122 - Gly B:123   [ RasMol ]  
    Thr A:133 - Gly A:134   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pn6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B3UWV7_MUHV1 | B3UWV7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B3UWV7_MUHV1 | B3UWV7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4PN6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PN6)