Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CBXYN10B FROM CALDICELLULOSIRUPTOR BESCII AND ITS MUTANT(E139A) IN COMPLEX WITH HYDROLYZED XYLOTETRAOSE
 
Authors :  J. An, Y. Feng, G. Wu
Date :  21 May 14  (Deposition) - 24 Jun 15  (Release) - 24 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Gh10 Family, Xylanase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. An, G. Wu, Y. Feng
Crystal Structure Of Cbxyn10B From Caldicellulosiruptor Bescii And Its Mutant(E139A) In Complex With Hydrolyzed Xylotetraose
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ENDO-1,4-BETA-XYLANASE
    ChainsA
    EC Number3.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21-CODONPLUS (DE3)-RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneATHE_0185
    Organism ScientificCALDICELLULOSIRUPTOR BESCII
    Organism Taxid521460
    StrainATCC BAA-1888 / DSM 6725 / Z-1320

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1BXP1Ligand/Ion4-O-BETA-D-XYLOPYRANOSYL-BETA-D-XYLOPYRANOSE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:50 , ASN A:51 , LYS A:54 , HIS A:87 , TRP A:91 , GLN A:94 , ASN A:138 , GLN A:215 , GLU A:247 , TRP A:297 , TRP A:305 , HOH A:550 , HOH A:593binding site for residue BXP A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PMD)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1His A:87 -Thr A:88
2Phe A:309 -Pro A:310

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PMD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PMD)

(-) Exons   (0, 0)

(no "Exon" information available for 4PMD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:329
                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh....eeeeeehhhhhhhhhhhhhhhhh.eeee....hhhhhh.......hhhhhhhhhhhhhh..eeeeeeeee....hhhh.ee..ee.hhhhhhhhhhhhhhhhhhhhh..eeeeeeee.............hhhhhhhh.hhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhhhhhh.....eeee..eee....hhhhhhhhhhhhhhh...eeeeeeeeee..............hhhhhhhhhhhhhhhhhhhhhh...eeeeee.......hhhhh...................hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pmd A  10 TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDFL 338
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PMD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PMD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PMD)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BXP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:87 - Thr A:88   [ RasMol ]  
    Phe A:309 - Pro A:310   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pmd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B9MMA5_CALBD | B9MMA5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  B9MMA5_CALBD | B9MMA5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B9MMA5_CALBD | B9MMA54l4o 4l4p

(-) Related Entries Specified in the PDB File

4l4o 4l4p