Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE CATALYTIC DOMAIN OF ETR1 FROM ARABIDOPSIS THALIANA
 
Authors :  S. Panneerselvam, J. Mueller-Dieckmann
Date :  16 May 14  (Deposition) - 17 Dec 14  (Release) - 11 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Etr1, Histidine Kinase, Ethylene Receptor, Cadmium, Adp, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Mayerhofer, S. Panneerselvam, H. Kaljunen, A. Tuukkanen, H. D. Mertens, J. Mueller-Dieckmann
Structural Model Of The Cytosolic Domain Of The Plant Ethylene Receptor 1 (Etr1).
J. Biol. Chem. V. 290 2644 2015
PubMed-ID: 25451923  |  Reference-DOI: 10.1074/JBC.M114.587667

(-) Compounds

Molecule 1 - ETHYLENE RECEPTOR 1
    Chains: A
    EC Number: 2.7.13.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUE 407-589
    Gene: ETR1, AT1G66340, T27F4.9
    Organism Common: THALE CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: ATETR1,PROTEIN ETHYLENE RESPONSE 1,PROTEIN ETR1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric/Biological Unit (4, 14)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
3CD11Ligand/IonCADMIUM ION
4CL1Ligand/IonCHLORIDE ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:466 , ASN A:470 , ADP A:613 , HOH A:723 , HOH A:726binding site for residue CD A 601
02AC2SOFTWARELYS A:473 , ADP A:613 , HOH A:723 , HOH A:726binding site for residue CD A 602
03AC3SOFTWAREASP A:513 , CYS A:573 , CL A:612 , ADP A:613binding site for residue CD A 603
04AC4SOFTWAREGLU A:565 , HOH A:728 , HOH A:729binding site for residue CD A 604
05AC5SOFTWAREHIS A:420 , GLU A:451 , HOH A:701 , HOH A:702 , HOH A:709binding site for residue CD A 605
06AC6SOFTWAREGLU A:413 , GLU A:425 , LYS A:458binding site for residue CD A 606
07AC7SOFTWAREGLU A:559binding site for residue CD A 607
08AC8SOFTWAREGLU A:413 , GLU A:457binding site for residue CD A 608
09AC9SOFTWAREHIS A:504 , HOH A:792binding site for residue CD A 609
10AD1SOFTWAREHIS A:504 , HOH A:757 , HOH A:799binding site for residue CD A 610
11AD2SOFTWAREASP A:567 , HOH A:730binding site for residue CD A 611
12AD3SOFTWAREGLY A:515 , ALA A:516 , GLY A:517 , GLY A:572 , CD A:603 , ADP A:613binding site for residue CL A 612
13AD4SOFTWAREASN A:466 , ASN A:470 , LYS A:473 , PHE A:474 , ASP A:513 , ILE A:526 , LYS A:529 , SER A:544 , GLY A:545 , GLY A:547 , LEU A:548 , CYS A:573 , CD A:601 , CD A:602 , CD A:603 , CL A:612 , HOH A:723 , HOH A:736 , HOH A:737 , HOH A:748 , HOH A:754 , HOH A:789binding site for residue ADP A 613
14AD5SOFTWAREHIS A:420 , LEU A:449binding site for residue ACT A 614

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PL9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PL9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PL9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PL9)

(-) Exons   (0, 0)

(no "Exon" information available for 4PL9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:150
                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeehhhhhhhhhhhhhhhhhhhh..eeeee......eeeehhhhhhhhhhhhhhhhhhhh....eeeeeeee...eeeeeeeee......hhhhhhhh......hhhhhhhhhhhhh..eeeee........eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4pl9 A 409 SLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSSHFYLRVKVKDSGAGINPQDIPKIFTKFSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGIS 584
                                   418       428       438       448       458       468       478       488||     511       521       544       554       564       574       584
                                                                                                          489|                        530|                                        
                                                                                                           503                         544
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PL9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PL9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PL9)

(-) Gene Ontology  (44, 44)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4pl9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pl9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ETR1_ARATH | P49333
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.13.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ETR1_ARATH | P49333
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ETR1_ARATH | P49333: 1dcf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PL9)