Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF CRUZAIN BOUND TO VINYL SULFONE ANALOG OF WRR-483 (WRR-666)
 
Authors :  A. Tochowicz, J. H. Mckerrow
Date :  08 May 14  (Deposition) - 12 Nov 14  (Release) - 10 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.27
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Cystein Protease, Cruzain, Chagas Disease, Covalent Inhibitor, Vinyl Sulfone Derivative, Analoge Of Wrr-483, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. D. Jones, A. Tochowicz, Y. Tang, M. D. Cameron, L. I. Mccall, K. Hirata, J. L. Siqueira-Neto, S. L. Reed, J. H. Mckerrow, W. R. Roush
Synthesis And Evaluation Of Oxyguanidine Analogues Of The Cysteine Protease Inhibitor Wrr-483 Against Cruzain.
Acs Med. Chem. Lett. V. 7 77 2016
PubMed-ID: 26819670  |  Reference-DOI: 10.1021/ACSMEDCHEMLETT.5B00336

(-) Compounds

Molecule 1 - CRUZIPAIN
    Chains: A, B
    EC Number: 3.4.22.51
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 122-337
    Organism Scientific: TRYPANOSOMA CRUZI
    Organism Taxid: 5693
    Synonym: CRUZAINE,MAJOR CYSTEINE PROTEINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
12V52Ligand/IonN-[(2S)-5-(CARBAMIMIDAMIDOOXY)-1-OXO-1-{[(1E,3S)-5-PHENYL-1-(PHENYLSULFONYL)PENT-1-EN-3-YL]AMINO}PENTAN-2-YL]-4-METHYLPIPERAZINE-1-CARBOXAMIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
12V51Ligand/IonN-[(2S)-5-(CARBAMIMIDAMIDOOXY)-1-OXO-1-{[(1E,3S)-5-PHENYL-1-(PHENYLSULFONYL)PENT-1-EN-3-YL]AMINO}PENTAN-2-YL]-4-METHYLPIPERAZINE-1-CARBOXAMIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
12V51Ligand/IonN-[(2S)-5-(CARBAMIMIDAMIDOOXY)-1-OXO-1-{[(1E,3S)-5-PHENYL-1-(PHENYLSULFONYL)PENT-1-EN-3-YL]AMINO}PENTAN-2-YL]-4-METHYLPIPERAZINE-1-CARBOXAMIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:19 , GLY A:23 , CYS A:25 , TRP A:26 , SER A:61 , CYS A:63 , GLY A:65 , GLY A:66 , LEU A:67 , ALA A:138 , MET A:145 , LEU A:160 , ASP A:161 , HIS A:162 , TRP A:184 , GLU A:208 , HOH A:573 , HOH A:588 , HOH A:638 , ASP B:161 , 2V5 B:301binding site for residue 2V5 A 301
2AC2SOFTWAREASP A:161 , 2V5 A:301 , GLN B:19 , GLY B:23 , SER B:24 , TRP B:26 , ALA B:27 , PHE B:28 , SER B:29 , SER B:61 , CYS B:63 , GLY B:65 , GLY B:66 , LEU B:67 , ALA B:138 , MET B:145 , LEU B:160 , ASP B:161 , HIS B:162 , GLY B:163 , TRP B:184 , GLU B:208 , HOH B:494 , HOH B:608binding site for Di-peptide 2V5 B 301 and CYS B 25

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:22 -A:63
2A:56 -A:101
3A:155 -A:203
4B:22 -B:63
5B:56 -B:101
6B:155 -B:203

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PI3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PI3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PI3)

(-) Exons   (0, 0)

(no "Exon" information available for 4PI3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.................hhhhhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhh.hhhhhhhhhhhhh..eee.......................eeee..eeee...hhhhhhhhhhhhh.eeeee.hhhhh.....ee.........eeeeeeeee......eeeee...........eeeee...hhhhh...eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pi3 A   1 APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG 215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     


Chain B from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.................hhhhhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhh.hhhhhhhhhhhhh..eee.......................eeee..eeee...hhhhhhhhhhhhh.eeeee.hhhhh.....ee.........eeeeeeeee......eeeee...........eeeee...hhhhh...eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pi3 B   1 APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG 215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PI3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PI3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PI3)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2V5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4pi3)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pi3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYSP_TRYCR | P25779
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.51
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYSP_TRYCR | P25779
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYSP_TRYCR | P25779: 1aim 1ewl 1ewm 1ewo 1ewp 1f29 1f2a 1f2b 1f2c 1me3 1me4 1u9q 2aim 2oz2 3hd3 3i06 3iut 3kku 3lxs 4klb 4qh6 4w5b 4w5c 4xui

(-) Related Entries Specified in the PDB File

2oz2 3lxs 4xui