Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  SWAPPED DIMER OF MYCOBACTERIAL ADENYLYL CYCLASE RV1625C: FORM 1
 
Authors :  D. V. Barathy, R. Mattoo, S. S. Visweswariah, K. Suguna
Date :  04 Mar 14  (Deposition) - 17 Sep 14  (Release) - 22 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Beta-Alpha-Beta Sandwich, Domain Swapping, Adenylyl Cyclase, Signal Transduction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Barathy, R. Mattoo, S. Visweswariah, K. Suguna
New Structural Forms Of A Mycobacterial Adenylyl Cyclase Rv1625C.
Iucrj V. 1 338 2014
PubMed-ID: 25295175  |  Reference-DOI: 10.1107/S2052252514016741

(-) Compounds

Molecule 1 - ADENYLATE CYCLASE
    Chains: A, B
    EC Number: 4.6.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P-PROEX-HT
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: CYA, RV1625C, MT1661, MTCY01B2.17C
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773
    Synonym: ATP PYROPHOSPHATE-LYASE, ADENYLYL CYCLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric Unit (2, 11)
No.NameCountTypeFull Name
1PEG9Ligand/IonDI(HYDROXYETHYL)ETHER
2SO42Ligand/IonSULFATE ION
Biological Unit 1 (2, 7)
No.NameCountTypeFull Name
1PEG5Ligand/IonDI(HYDROXYETHYL)ETHER
2SO42Ligand/IonSULFATE ION
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1PEG4Ligand/IonDI(HYDROXYETHYL)ETHER
2SO4-1Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:274 , ARG A:278 , ARG B:274 , ARG B:278binding site for residue SO4 A 501
02AC2SOFTWAREARG A:405 , HOH A:602 , HOH A:607 , HOH A:610 , LYS B:411 , VAL B:426binding site for residue SO4 A 502
03AC3SOFTWAREVAL B:356 , PHE B:362 , PEG B:504binding site for residue PEG A 503
04AC4SOFTWAREGLU A:391 , ARG A:395 , THR B:349 , GLY B:350binding site for residue PEG A 504
05AC5SOFTWAREARG A:417binding site for residue PEG A 505
06AC6SOFTWARELYS A:246 , ASP A:248 , PRO A:351 , VAL A:353 , GLY B:368 , ASP B:369binding site for residue PEG A 506
07AC7SOFTWAREHIS A:290 , ARG A:312 , ASP A:314 , ALA A:318 , ASP A:321binding site for residue PEG A 507
08AC8SOFTWAREASP B:314 , ALA B:318 , ASP B:321binding site for residue PEG B 501
09AC9SOFTWAREASP B:284 , VAL B:287 , ASP B:288 , LEU B:292 , GLU B:293 , LYS B:294binding site for residue PEG B 502
10AD1SOFTWARELYS B:246 , TYR B:247 , ASP B:248 , PRO B:351 , VAL B:352binding site for residue PEG B 503
11AD2SOFTWAREPEG A:503 , ARG B:360 , PHE B:362binding site for residue PEG B 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4P2M)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Ile A:257 -Val A:258
2Val A:308 -Pro A:309
3Gln A:332 -Leu A:333
4Val B:308 -Pro B:309
5Gly B:412 -Lys B:413

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P2M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P2M)

(-) Exons   (0, 0)

(no "Exon" information available for 4P2M)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:169
                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeee...hhhhhhhhhhhhhhhhh..ee.......eeeee.......hhhhhhhhhhhhhhhhhh..........eeeeeeeeeeeeeeeeeeeeeeeehhhhhhhhhhhhh.....eeehhhhhhhhh..eeeeeeeeee...eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p2m A 240 RNIIADKYDEASVLFADIVVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLDPRGNVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGVMRTWYLIGRKV 426
                                   249       273       283       293       303       313       323       333|   || 345       355       365       375       385       395       405     ||417         
                                            258|                                                         333| 339|                                                                   411|            
                                             273                                                          335  341                                                                    414            


Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeeee......hhhhhhhhhhhhhhhhhh..eee......eeeee.......hhhhhhhhhhhhhhhhhhhh.........eeeeeeeeeeeeeeeeeeeeeeeeehhhhhhhhhhhhh.....eeeehhhhhhhh..eeeeeeeee......eeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p2m B 240 RNIIADKYDEASVLFADIVGFTDLVRFLDRLYSAFDELVDQHGLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRGNPVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINKGKGVMRTWYLIGRKVAA 428
                                   249       259 ||    278       288       298       308       318       328       338       348       358       368       378       388       398       408||     419         
                                               261|                                                                                                                                       409|                 
                                                271                                                                                                                                        411
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P2M)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P2M)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P2M)

(-) Gene Ontology  (17, 30)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:332 - Leu A:333   [ RasMol ]  
    Gly B:412 - Lys B:413   [ RasMol ]  
    Ile A:257 - Val A:258   [ RasMol ]  
    Val A:308 - Pro A:309   [ RasMol ]  
    Val B:308 - Pro B:309   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p2m
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYA1_MYCTO | P9WQ34
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CYA1_MYCTU | P9WQ35
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.6.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYA1_MYCTO | P9WQ34
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CYA1_MYCTU | P9WQ35
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYA1_MYCTO | P9WQ34: 1yk9 4p2f 4p2x
        CYA1_MYCTU | P9WQ35: 1yk9 4p2f 4p2x

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4P2M)