4OYU - JenaLib

Title :   CRYSTAL STRUCTURE OF THE N-TERMINAL DOMAINS OF MUSKELIN

Authors :   C. Delto, J. Kuper, H. Schindelin

Date :   06 Feb 14 (Deposition) - 11 Feb 15 (Release) - 25 Mar 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Discoidin Domain, Lish Motif, Dimer, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. F. Delto, F. F. Heisler, J. Kuper, B. Sander, M. Kneussel, H. Schindelin
The Lish Motif Of Muskelin Is Crucial For Oligomerization And Governs Intracellular Localization.
Structure V. 23 364 2015
PubMed-ID: 25579817 | Reference-DOI: 10.1016/J.STR.2014.11.016

Compounds

Molecule 1 - MUSKELIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21-CODONPLUS(DE3)-RIL
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 12-205
	Gene	:	MKLN1, MSK
	Organism Common	:	RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116

Structural Features

Chains, Units

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (2, 24)

Sites (24, 24)

Asymmetric Unit (24, 24)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	LEU A:15 , PRO A:17 , TYR A:18 , LEU A:36 , VAL A:150 , HOH A:466	binding site for residue EDO A 301
02	AC2	SOFTWARE	TRP A:23 , GLU A:175 , HOH A:405 , HOH A:410	binding site for residue EDO A 302
03	AC3	SOFTWARE	GLN A:124 , PRO A:163 , TRP A:167 , MET B:11 , ILE B:155	binding site for residue EDO A 303
04	AC4	SOFTWARE	MET A:98 , LYS A:132 , HOH A:541	binding site for residue EDO A 304
05	AC5	SOFTWARE	ILE A:59 , GLU A:95 , LYS A:132 , EDO A:313 , HOH A:456 , HOH A:529	binding site for residue EDO A 305
06	AC6	SOFTWARE	LYS B:112	binding site for residue EDO A 306
07	AC7	SOFTWARE	SER A:25 , GLU A:50 , SER A:51 , GLN A:56 , HOH A:478 , CYS B:13	binding site for residue EDO A 307
08	AC8	SOFTWARE	GLU A:173 , ILE A:177 , HOH A:415 , HOH A:416 , THR B:29	binding site for residue EDO A 308
09	AC9	SOFTWARE	GLU A:113 , THR A:114	binding site for residue EDO A 309
10	AD1	SOFTWARE	TYR A:53 , THR B:114 , GLU B:151 , HOH B:409 , HOH B:410	binding site for residue EDO A 310
11	AD2	SOFTWARE	HIS A:21 , GLU A:175	binding site for residue GOL A 311
12	AD3	SOFTWARE	SER A:27 , GLU A:50 , ASN A:144 , HOH A:420 , GLU B:12 , GLN B:43	binding site for residue EDO A 312
13	AD4	SOFTWARE	PRO A:55 , GLN A:56 , TYR A:57 , LYS A:132 , VAL A:134 , EDO A:305 , HOH A:541	binding site for residue EDO A 313
14	AD5	SOFTWARE	MET A:11 , GLU A:12 , TRP B:167 , TYR B:171 , GLN B:174	binding site for residue EDO A 314
15	AD6	SOFTWARE	LYS B:88 , GLU B:100 , SER B:103 , HOH B:451	binding site for residue EDO B 301
16	AD7	SOFTWARE	TRP B:23 , GLN B:174 , GLU B:175 , HOH B:412 , HOH B:435	binding site for residue EDO B 302
17	AD8	SOFTWARE	PHE B:90 , GLU B:95 , GLU B:96 , ASN B:97 , MET B:98 , LYS B:132 , EDO B:304	binding site for residue EDO B 303
18	AD9	SOFTWARE	ILE B:59 , GLU B:95 , MET B:98 , LYS B:132 , EDO B:303 , EDO B:305 , HOH B:450	binding site for residue EDO B 304
19	AE1	SOFTWARE	LYS B:132 , EDO B:304 , HOH B:452	binding site for residue EDO B 305
20	AE2	SOFTWARE	GLY B:92 , MET B:93 , ASN B:94 , GLU B:96 , ASN B:97 , HOH B:454	binding site for residue EDO B 306
21	AE3	SOFTWARE	PRO B:65 , ASP B:156 , PRO B:158 , VAL B:161 , GLN B:162	binding site for residue EDO B 307
22	AE4	SOFTWARE	ASP B:159 , GLN B:162 , PRO B:163	binding site for residue EDO B 308
23	AE5	SOFTWARE	LEU B:15 , TYR B:18 , LEU B:36 , TYR B:149 , VAL B:150 , HOH B:463 , HOH B:524	binding site for residue EDO B 309
24	AE6	SOFTWARE	GLU B:113 , THR B:114 , PHE B:115 , HOH B:525	binding site for residue EDO B 310

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:178
                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee..eeeeee.......hhhhhhh.........ee.........eeeeeeeeeeeeeeeee.........eeeeeeeee......eeeeee........eeee...ee..ee..eeeeeeeeeee.......ee.eeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4oyu A  11 MECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN 188
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee..eeeeee.......hhhhhhh.........ee.........eeeeeeeeeeeeeeeee.........eeeeeeeee......eeeeee........eeee...ee..ee..eeeeeeeeeee.......ee.eeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4oyu B  10 AMECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN 188
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:54 - Pro A:55	[ RasMol ]
		Pro B:54 - Pro B:55	[ RasMol ]
		Trp B:139 - Gly B:140	[ RasMol ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4oyu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MKLN1_RAT \| Q99PV3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MKLN1_RAT \| Q99PV3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description