Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NITROSOMONAS EUROPEA HAO
 
Authors :  W. J. Maalcke, A. Dietl, S. J. Marritt, J. N. Butt, M. S. M. Jetten, J. T. Ke T. R. M. B. Barends, B. Kartal
Date :  08 Oct 13  (Deposition) - 11 Dec 13  (Release) - 09 Apr 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  C-Type Cytochrome, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. J. Maalcke, A. Dietl, S. J. Marritt, J. N. Butt, M. S. Jetten, J. T. Keltjens, T. R. Barends, B. Kartal
Structural Basis Of Biological No Generation By Octaheme Oxidoreductases.
J. Biol. Chem. V. 289 1228 2014
PubMed-ID: 24302732  |  Reference-DOI: 10.1074/JBC.M113.525147

(-) Compounds

Molecule 1 - HYDROXYLAMINE OXIDOREDUCTASE
    Chains: A, C, E
    EC Number: 1.7.2.6
    Fragment: UNP RESIDUES 25-528
    Organism Scientific: NITROSOMONAS EUROPAEA
    Organism Taxid: 915
    Synonym: HAO
 
Molecule 2 - HYDROXYLAMINE OXIDOREDUCTASE
    Chains: B, D, F
    EC Number: 1.7.2.6
    Fragment: UNP RESIDUES 28-84
    Organism Scientific: NITROSOMONAS EUROPAEA
    Organism Taxid: 915

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 26)

Asymmetric/Biological Unit (4, 26)
No.NameCountTypeFull Name
1HEC3Ligand/IonHEME C
2HEM21Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
3K1Ligand/IonPOTASSIUM ION
4PO41Ligand/IonPHOSPHATE ION

(-) Sites  (26, 26)

Asymmetric Unit (26, 26)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:140 , LYS A:141 , CYS A:196 , HIS A:200 , GLU A:203 , HIS A:228 , ASN A:259 , CYS A:263 , CYS A:266 , HIS A:267 , SER A:277 , ARG A:278 , ARG A:319 , LEU A:320 , MET A:339 , HIS A:347 , HEM A:602 , HEM A:606 , HOH A:767 , HOH A:785 , HOH A:979BINDING SITE FOR RESIDUE HEM A 601
02AC2SOFTWARETHR A:122 , HIS A:123 , LYS A:141 , LYS A:144 , LEU A:145 , VAL A:148 , VAL A:167 , CYS A:196 , CYS A:199 , HIS A:200 , CYS A:263 , HIS A:267 , PHE A:272 , SER A:273 , ALA A:274 , HEM A:601 , HEM A:604 , HOH A:825 , HOH A:903BINDING SITE FOR RESIDUE HEM A 602
03AC3SOFTWARETYR A:81 , TYR A:88 , ASP A:102 , CYS A:103 , CYS A:106 , HIS A:107 , GLU A:110 , CYS A:169 , HIS A:173 , HIS A:184 , ILE A:188 , MET A:190 , HEM A:604 , HOH A:838 , SER C:389 , GLU C:390 , ARG C:391BINDING SITE FOR RESIDUE HEM A 603
04AC4SOFTWARETYR A:81 , PRO A:84 , HIS A:107 , TRP A:114 , TRP A:118 , HIS A:123 , VAL A:167 , GLY A:168 , CYS A:169 , CYS A:172 , HIS A:173 , MET A:190 , PRO A:191 , LYS A:262 , ASP A:264 , ARG A:269 , HIS A:270 , PHE A:272 , HEM A:602 , HEM A:603 , HIS C:388 , SER C:389 , HOH C:776BINDING SITE FOR RESIDUE HEM A 604
05AC5SOFTWAREHIS A:287 , ASN A:294 , TYR A:298 , PRO A:332 , THR A:333 , CYS A:334 , CYS A:337 , HIS A:338 , THR A:353 , ARG A:354 , TRP A:355 , ALA A:356 , TRP A:380 , MET A:400 , HIS A:483 , HEM A:606 , HEM A:607 , HOH A:711 , HOH A:858 , HEC C:601BINDING SITE FOR RESIDUE HEM A 605
06AC6SOFTWAREPRO A:226 , SER A:227 , HIS A:228 , ASP A:231 , ALA A:234 , CYS A:256 , HIS A:257 , ASN A:259 , ASN A:265 , CYS A:266 , ALA A:282 , CYS A:283 , CYS A:286 , HIS A:287 , CYS A:334 , HIS A:338 , ILE A:349 , THR A:353 , ALA A:356 , HEM A:601 , HEM A:605 , HOH A:749 , HEC C:601BINDING SITE FOR RESIDUE HEM A 606
07AC7SOFTWAREHIS A:303 , LEU A:306 , PHE A:324 , ASN A:330 , ALA A:331 , PRO A:332 , THR A:383 , CYS A:384 , CYS A:387 , HIS A:388 , PHE A:392 , TYR A:396 , VAL A:484 , HEM A:605 , HOH A:709 , HOH A:908 , LYS E:262 , ASP E:264 , THR E:268 , ARG E:269 , HOH E:719 , HOH E:818BINDING SITE FOR RESIDUE HEM A 607
08AC8SOFTWARETHR A:490 , TYR A:491 , HOH A:788 , HOH A:971 , TRP E:221 , ARG E:225 , ALA E:234 , ASN E:235 , THR E:238 , TRP E:241 , CYS E:253 , CYS E:256 , HIS E:257 , THR E:285 , CYS E:286 , HIS E:287 , HIS E:292 , ASN E:357 , PHE E:452 , HEM E:606 , HEM E:607 , HOH E:713 , HOH E:779BINDING SITE FOR RESIDUE HEC A 608
09AC9SOFTWAREASP A:312 , HOH A:916 , ASP C:312 , ASP E:312BINDING SITE FOR RESIDUE K A 609
10BC1SOFTWARETRP A:221 , ARG A:225 , ALA A:234 , ASN A:235 , THR A:238 , TRP A:241 , GLY A:252 , CYS A:253 , CYS A:256 , HIS A:257 , THR A:285 , CYS A:286 , HIS A:287 , HIS A:292 , ASN A:357 , PHE A:452 , HEM A:605 , HEM A:606 , HOH A:775 , HOH A:968 , THR C:490 , TYR C:491 , HOH C:704 , HOH C:851BINDING SITE FOR RESIDUE HEC C 601
11BC2SOFTWARETYR C:140 , LYS C:141 , CYS C:196 , HIS C:200 , GLU C:203 , HIS C:228 , ASN C:259 , CYS C:263 , CYS C:266 , HIS C:267 , SER C:277 , ARG C:278 , ARG C:319 , LEU C:320 , MET C:339 , HIS C:347 , HEM C:603 , HEM C:607 , HOH C:710 , HOH C:770 , HOH C:873BINDING SITE FOR RESIDUE HEM C 602
12BC3SOFTWARETHR C:122 , HIS C:123 , LYS C:141 , LYS C:144 , LEU C:145 , VAL C:167 , VAL C:176 , CYS C:196 , CYS C:199 , HIS C:200 , CYS C:263 , HIS C:267 , PHE C:272 , SER C:273 , ALA C:274 , HEM C:602 , HEM C:605 , HOH C:798 , HOH C:824BINDING SITE FOR RESIDUE HEM C 603
13BC4SOFTWARELYS A:161 , TYR C:81 , TYR C:88 , PRO C:94 , ASP C:102 , CYS C:103 , CYS C:106 , HIS C:107 , GLU C:110 , CYS C:169 , HIS C:173 , HIS C:184 , ILE C:188 , MET C:190 , HEM C:605 , HOH C:778 , HOH C:817 , SER E:389 , GLU E:390 , ARG E:391BINDING SITE FOR RESIDUE HEM C 604
14BC5SOFTWARETYR C:81 , PRO C:84 , HIS C:107 , TRP C:114 , HIS C:123 , VAL C:167 , GLY C:168 , CYS C:169 , CYS C:172 , HIS C:173 , MET C:190 , PRO C:191 , LYS C:262 , ASP C:264 , ARG C:269 , HIS C:270 , PHE C:272 , HEM C:603 , HEM C:604 , HIS E:388 , SER E:389 , HOH E:757BINDING SITE FOR RESIDUE HEM C 605
15BC6SOFTWAREHIS C:287 , ASN C:294 , TYR C:298 , PRO C:332 , THR C:333 , CYS C:334 , CYS C:337 , HIS C:338 , THR C:353 , ARG C:354 , TRP C:355 , ALA C:356 , TRP C:380 , MET C:400 , ALA C:482 , HIS C:483 , HEM C:607 , HEM C:608 , HOH C:702 , HOH C:840 , HEC E:601BINDING SITE FOR RESIDUE HEM C 606
16BC7SOFTWAREPRO C:226 , SER C:227 , HIS C:228 , ASP C:231 , ALA C:234 , CYS C:256 , HIS C:257 , ASN C:259 , ASN C:265 , CYS C:266 , ALA C:282 , CYS C:283 , CYS C:286 , HIS C:287 , CYS C:334 , ILE C:349 , THR C:353 , ALA C:356 , HEM C:602 , HEM C:606 , HOH C:857 , HEC E:601BINDING SITE FOR RESIDUE HEM C 607
17BC8SOFTWARELYS A:262 , ASP A:264 , THR A:268 , ARG A:269 , HOH A:808 , HIS C:303 , PHE C:324 , ASN C:330 , PRO C:332 , THR C:383 , CYS C:384 , CYS C:387 , HIS C:388 , PHE C:392 , TYR C:396 , VAL C:484 , HEM C:606 , HOH C:776 , HOH C:812BINDING SITE FOR RESIDUE HEM C 608
18BC9SOFTWARETRP C:221 , ARG C:225 , ALA C:234 , ASN C:235 , THR C:238 , GLY C:252 , CYS C:253 , CYS C:256 , HIS C:257 , THR C:285 , CYS C:286 , HIS C:287 , HIS C:292 , ASN C:357 , PHE C:452 , HEM C:606 , HEM C:607 , HOH C:729 , THR E:490 , TYR E:491 , HOH E:704 , HOH E:753 , HOH E:948BINDING SITE FOR RESIDUE HEC E 601
19CC1SOFTWARETYR E:140 , LYS E:141 , CYS E:196 , HIS E:200 , GLU E:203 , HIS E:228 , ASN E:259 , CYS E:263 , CYS E:266 , HIS E:267 , SER E:277 , ARG E:278 , ARG E:319 , LEU E:320 , MET E:339 , HIS E:347 , HEM E:603 , HEM E:607 , HOH E:799 , HOH E:851 , HOH E:886BINDING SITE FOR RESIDUE HEM E 602
20CC2SOFTWARETHR E:122 , HIS E:123 , LYS E:141 , LYS E:144 , LEU E:145 , VAL E:167 , CYS E:196 , CYS E:199 , HIS E:200 , CYS E:263 , HIS E:267 , PHE E:272 , ALA E:274 , HEM E:602 , HEM E:605 , HOH E:765 , HOH E:891BINDING SITE FOR RESIDUE HEM E 603
21CC3SOFTWARESER A:389 , GLU A:390 , ARG A:391 , TYR E:81 , TYR E:88 , PRO E:94 , GLU E:96 , ASP E:102 , CYS E:103 , CYS E:106 , HIS E:107 , GLU E:110 , HIS E:173 , HIS E:184 , ILE E:188 , HEM E:605 , HOH E:792 , HOH E:993BINDING SITE FOR RESIDUE HEM E 604
22CC4SOFTWAREHIS A:388 , SER A:389 , HOH A:709 , TYR E:81 , PRO E:84 , HIS E:107 , TRP E:114 , HIS E:123 , VAL E:167 , GLY E:168 , CYS E:169 , CYS E:172 , HIS E:173 , MET E:190 , PRO E:191 , LYS E:262 , ASP E:264 , ARG E:269 , HIS E:270 , PHE E:272 , HEM E:603 , HEM E:604BINDING SITE FOR RESIDUE HEM E 605
23CC5SOFTWAREHEC A:608 , CYS E:283 , HIS E:287 , ASN E:294 , TYR E:298 , PRO E:332 , THR E:333 , CYS E:334 , CYS E:337 , HIS E:338 , THR E:353 , ARG E:354 , TRP E:355 , ALA E:356 , TRP E:380 , MET E:400 , ALA E:482 , HIS E:483 , HEM E:607 , HEM E:608 , HOH E:706BINDING SITE FOR RESIDUE HEM E 606
24CC6SOFTWAREHEC A:608 , PRO E:226 , SER E:227 , HIS E:228 , ASP E:231 , ALA E:234 , CYS E:256 , HIS E:257 , ASN E:259 , ASN E:265 , CYS E:266 , ALA E:282 , CYS E:283 , CYS E:286 , HIS E:287 , CYS E:334 , HIS E:338 , ILE E:349 , THR E:353 , ALA E:356 , HEM E:602 , HEM E:606 , HOH E:717BINDING SITE FOR RESIDUE HEM E 607
25CC7SOFTWARETRP C:114 , LYS C:262 , ASP C:264 , THR C:268 , ARG C:269 , HOH C:735 , HIS E:303 , LEU E:306 , ASN E:330 , PRO E:332 , THR E:383 , CYS E:384 , CYS E:387 , HIS E:388 , PHE E:392 , TYR E:396 , VAL E:484 , HEM E:606 , HOH E:757 , HOH E:776 , HOH E:782BINDING SITE FOR RESIDUE HEM E 608
26CC8SOFTWARELEU E:39 , ASP E:40 , LYS E:43 , GLU E:48 , HOH E:989BINDING SITE FOR RESIDUE PO4 E 609

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1B:44 -B:69
2D:44 -D:69
3F:44 -F:69

(-) Cis Peptide Bonds  (15, 15)

Asymmetric/Biological Unit
No.Residues
1Ser A:93 -Pro A:94
2Arg A:225 -Pro A:226
3Arg A:269 -His A:270
4Glu A:439 -Pro A:440
5Asn A:458 -Pro A:459
6Ser C:93 -Pro C:94
7Arg C:225 -Pro C:226
8Arg C:269 -His C:270
9Glu C:439 -Pro C:440
10Asn C:458 -Pro C:459
11Ser E:93 -Pro E:94
12Arg E:225 -Pro E:226
13Arg E:269 -His E:270
14Glu E:439 -Pro E:440
15Asn E:458 -Pro E:459

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4N4N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4N4N)

(-) Exons   (0, 0)

(no "Exon" information available for 4N4N)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:504
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains d4n4na_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhh.......hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh............hhhhhhh.......ee........hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh.hhhhhhhhhhh................hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.......hhhhh.........hhhhhhhee..ee........................hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4n4n A  25 DISTVPDETYDALKLDRGKATPKETYEALVKRYKDPAHGAGKGTMGDYWEPIAISIYMDPNTFYKPPVSPKEVAERKDCVECHSDETPVWVRAWKRSTHANLDKIRNLKSDDPLYYKKGKLEEVENNLRSMGKLGEKETLKEVGCIDCHVDVNKKDKADHTKDIRMPTADTCGTCHLREFAERESERDTMVWPNGQWPAGRPSHALDYTANIETTVWAAMPQREVAEGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNWEAYTMSKHGKLAEMNRDKWNWEVRLKDAFSKGGQNAPTCAACHMEYEGEYTHNITRKTRWANYPFVPGIAENITSDWSEARLDSWVLTCTQCHSERFARSYLDLMDKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPEPEKPGFGIFTQLFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNRAYVEIQDEYTKMQELSALQARVNKLEGK 528
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524    


Chain B from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhh.......eeeeeeeee..eeeeeehhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 4n4n B  29 SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQSG  84
                                    38        48        58        68        78      


Chain C from PDB  Type:PROTEIN  Length:502
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4n4nc_ C: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhh.......hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh............hhhhhhh.......ee........hhhhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh.hhhhhhhhhhh................hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.......hhhhhh........hhhhhhhee..ee...................hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4n4n C  25 DISTVPDETYDALKLDRGKATPKETYEALVKRYKDPAHGAGKGTMGDYWEPIAISIYMDPNTFYKPPVSPKEVAERKDCVECHSDETPVWVRAWKRSTHANLDKIRNLKSDDPLYYKKGKLEEVENNLRSMGKLGEKETLKEVGCIDCHVDVNKKDKADHTKDIRMPTADTCGTCHLREFAERESERDTMVWPNGQWPAGRPSHALDYTANIETTVWAAMPQREVAEGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNWEAYTMSKHGKLAEMNRDKWNWEVRLKDAFSKGGQNAPTCAACHMEYEGEYTHNITRKTRWANYPFVPGIAENITSDWSEARLDSWVLTCTQCHSERFARSYLDLMDKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPEPEKPGFGIFTQLFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNRAYVEIQDEYTKMQELSALQARVNKLE 526
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524  


Chain D from PDB  Type:PROTEIN  Length:57
                                                                                         
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhh.......eeeeeeeee..eeeeeehhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                 4n4n D  28 SSLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQSG  84
                                    37        47        57        67        77       


Chain E from PDB  Type:PROTEIN  Length:503
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains d4n4ne_ E: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhh.......hhhhhhhhhhhhhhhhhhh.....hhhhh....hhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh............hhhhhhh.......ee........hhhhhhh.hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh.hhhhhhhhhhh................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh.......hhhhh.........hhhhhhhee..ee........................hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4n4n E  25 DISTVPDETYDALKLDRGKATPKETYEALVKRYKDPAHGAGKGTMGDYWEPIAISIYMDPNTFYKPPVSPKEVAERKDCVECHSDETPVWVRAWKRSTHANLDKIRNLKSDDPLYYKKGKLEEVENNLRSMGKLGEKETLKEVGCIDCHVDVNKKDKADHTKDIRMPTADTCGTCHLREFAERESERDTMVWPNGQWPAGRPSHALDYTANIETTVWAAMPQREVAEGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNWEAYTMSKHGKLAEMNRDKWNWEVRLKDAFSKGGQNAPTCAACHMEYEGEYTHNITRKTRWANYPFVPGIAENITSDWSEARLDSWVLTCTQCHSERFARSYLDLMDKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPEPEKPGFGIFTQLFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNRAYVEIQDEYTKMQELSALQARVNKLEG 527
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524   


Chain F from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhh.......eeeeeeeee..eeeeeehhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 4n4n F  28 SSLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQS  83
                                    37        47        57        67        77
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4N4N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4N4N)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:225 - Pro A:226   [ RasMol ]  
    Arg A:269 - His A:270   [ RasMol ]  
    Arg C:225 - Pro C:226   [ RasMol ]  
    Arg C:269 - His C:270   [ RasMol ]  
    Arg E:225 - Pro E:226   [ RasMol ]  
    Arg E:269 - His E:270   [ RasMol ]  
    Asn A:458 - Pro A:459   [ RasMol ]  
    Asn C:458 - Pro C:459   [ RasMol ]  
    Asn E:458 - Pro E:459   [ RasMol ]  
    Glu A:439 - Pro A:440   [ RasMol ]  
    Glu C:439 - Pro C:440   [ RasMol ]  
    Glu E:439 - Pro E:440   [ RasMol ]  
    Ser A:93 - Pro A:94   [ RasMol ]  
    Ser C:93 - Pro C:94   [ RasMol ]  
    Ser E:93 - Pro E:94   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4n4n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HAO_NITEU | Q50925
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q82V11_NITEU | Q82V11
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.7.2.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HAO_NITEU | Q50925
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q82V11_NITEU | Q82V11
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HAO_NITEU | Q50925: 1fgj 4fas 4n4o
UniProtKB/TrEMBL
        Q82V11_NITEU | Q82V11: 4fas 4n4o

(-) Related Entries Specified in the PDB File

4n4j 4n4k 4n4l 4n4m 4n4o