Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  A125C NS2B-NS3 PROTEASE FROM DENGUE VIRUS AT PH 5.5
 
Authors :  M. Yildiz, J. A. Hardy
Date :  14 Aug 13  (Deposition) - 27 Nov 13  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Serine Protease, Allosteric Inhibition, Dengue Virus Protease, Trypsin-Like Protease, Conformational Flexibility, Viral Protease, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Yildiz, S. Ghosh, J. A. Bell, W. Sherman, J. A. Hardy
Allosteric Inhibition Of The Ns2B-Ns3 Protease From Dengue Virus.
Acs Chem. Biol. V. 8 2744 2013
PubMed-ID: 24164286  |  Reference-DOI: 10.1021/CB400612H

(-) Compounds

Molecule 1 - NS2B-NS3 PROTEASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidDVP2
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePET15B
    FragmentUNP RESIDUES 1394-1440, 1476-1660
    GeneNS2B-NS3
    MutationYES
    Organism ScientificDENGUE VIRUS 2
    Organism Taxid11060

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4M9I)

(-) Sites  (0, 0)

(no "Site" information available for 4M9I)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4M9I)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4M9I)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4M9I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4M9I)

(-) Exons   (0, 0)

(no "Exon" information available for 4M9I)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:199
                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee....hhhhhhhheee..................eeeeeeeee..eeeeeeeeeee..eeeehhhhhh...eee..eee.eeeee....eeee...............eeeee.......eeeee..eeeee..eeeeee....hhhhh..eee.....eeee...eee.....eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4m9i A   43 GSHMLEADLELERAADVRWEEQAEISGSSPILSISIKNEEEEQTLGEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNTGTIGCVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIANTEKS 1171
                                    52        62        72   ||   90     |1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162         
                                                            76|         96|                                                                                                                                                        
                                                             85        1019                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4M9I)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4M9I)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4M9I)

(-) Gene Ontology  (45, 45)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4m9i)
 
  Sites
(no "Sites" information available for 4m9i)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4m9i)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4m9i
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q91H74_9FLAV | Q91H74
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q91H74_9FLAV | Q91H74
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q91H74_9FLAV | Q91H742bhr 2bmf 2fom 4m9f 4m9k 4m9m 4m9t

(-) Related Entries Specified in the PDB File

2fom 3u1i 3u1j 4m9f 4m9k 4m9m 4m9t