Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A VERTEBRATE RNA BINDING DOMAIN OF TELOMERASE (TRBD)
 
Authors :  M. Harkisheimer, M. Mason, E. Shuvaeva, E. Skordalakes
Date :  10 Jul 13  (Deposition) - 09 Oct 13  (Release) - 30 Oct 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.37
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Rna Binding Domain Of The Reverse Transcriptase Telomerase, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Harkisheimer, M. Mason, E. Shuvaeva, E. Skordalakes
A Motif In The Vertebrate Telomerase N-Terminal Linker Of Tert Contributes To Rna Binding And Telomerase Activity And Processivity.
Structure V. 21 1870 2013
PubMed-ID: 24055314  |  Reference-DOI: 10.1016/J.STR.2013.08.013

(-) Compounds

Molecule 1 - TELOMERASE REVERSE TRANSCRIPTASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RNA BINDING DOMAIN (UNP RESIDUES 295-544)
    Gene: TERT
    Organism Common: TIGER PUFFER
    Organism Scientific: TAKIFUGU RUBRIPES
    Organism Taxid: 31033

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4LMO)

(-) Sites  (0, 0)

(no "Site" information available for 4LMO)

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:386 -A:407
2B:386 -B:407
3C:386 -C:407
4D:386 -D:407

(-) Cis Peptide Bonds  (15, 15)

Asymmetric Unit
No.Residues
1Lys A:351 -Pro A:352
2Ser A:516 -Met A:517
3Met A:517 -Gly A:518
4Lys A:520 -Asn A:521
5Lys B:351 -Pro B:352
6Ala B:394 -Gly B:395
7Ser B:448 -Gly B:449
8Lys C:351 -Pro C:352
9Asp C:393 -Ala C:394
10Ala C:394 -Gly C:395
11Gly C:395 -Gln C:396
12Gly C:449 -Lys C:450
13Ile C:543 -Ser C:544
14Lys D:351 -Pro D:352
15Ala D:394 -Gly D:395

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LMO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LMO)

(-) Exons   (0, 0)

(no "Exon" information available for 4LMO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:251
                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..hhhhhhhhh.ee....ee..hhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh...hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee.........eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lmo A 294 SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS 544
                                   303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543 


Chain B from PDB  Type:PROTEIN  Length:251
                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..hhhhhhhhh.ee....ee..hhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhh...hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee.........eeeehhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lmo B 294 SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS 544
                                   303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543 


Chain C from PDB  Type:PROTEIN  Length:251
                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..hhhhhhhhh.ee....ee..hhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhh..hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee.......eeeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lmo C 294 SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS 544
                                   303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543 


Chain D from PDB  Type:PROTEIN  Length:251
                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh..hhhhhhhh.eee....eee.hhhhhhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhh.............hhhhh.....hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.....hhhhhhh..hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee.......eeeeehhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lmo D 294 SQSFMRTLGFLYGGRGMRSFLLNRKKKTAEGFRKIQGRDLIRIVFFEGVLYLNGLERKPKKLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQAELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSGKFERLSVAELMWKIKVNNCDWLKISKTGRVPPSELSYRTQILGQFLAWLLDGFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHIS 544
                                   303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4LMO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LMO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LMO)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4lmo)
 
  Sites
(no "Sites" information available for 4lmo)
 
  Cis Peptide Bonds
    Ala B:394 - Gly B:395   [ RasMol ]  
    Ala C:394 - Gly C:395   [ RasMol ]  
    Ala D:394 - Gly D:395   [ RasMol ]  
    Asp C:393 - Ala C:394   [ RasMol ]  
    Gly C:395 - Gln C:396   [ RasMol ]  
    Gly C:449 - Lys C:450   [ RasMol ]  
    Ile C:543 - Ser C:544   [ RasMol ]  
    Lys A:351 - Pro A:352   [ RasMol ]  
    Lys A:520 - Asn A:521   [ RasMol ]  
    Lys B:351 - Pro B:352   [ RasMol ]  
    Lys C:351 - Pro C:352   [ RasMol ]  
    Lys D:351 - Pro D:352   [ RasMol ]  
    Met A:517 - Gly A:518   [ RasMol ]  
    Ser A:516 - Met A:517   [ RasMol ]  
    Ser B:448 - Gly B:449   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4lmo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TERT_TAKRU | Q4KTA7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TERT_TAKRU | Q4KTA7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4LMO)

(-) Related Entries Specified in the PDB File

2r4g 3du5 3du6