Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF 3-OXOACYL (ACYL-CARRIER-PROTEIN) REDUCTASE (TARGET EFI-506442) FROM AGROBACTERIUM TUMEFACIENS C58 WITH NADP BOUND
 
Authors :  Y. Patskovsky, R. Toro, R. Bhosle, B. Hillerich, R. D. Seidel, E. Washin A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, W. D. Zencheck, H N. F. Al Obaidi, M. Stead, J. Love, J. A. Gerlt, S. C. Almo, Enzyme Func Initiative (Efi)
Date :  03 Jan 13  (Deposition) - 16 Jan 13  (Release) - 16 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.96
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Oxidoreductase, Nicotinamide Adenine Dinucleotide Phosphate, Nadp, Structural Genomics, Enzyme Initiative, Efi (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Patskovsky, R. Toro, R. Bhosle, B. Hillerich, R. D. Seidel, E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, W. D. Zencheck, H. J. Imker, N. F. Al Obaidi, M. Stead, J. Love, J. A. Gerlt, S. C. Almo
Crystal Structure Of 3-Oxoacyl (Acyl-Carrier-Protein) Reductase Atu5465 From Agrobacterium Tumefaciens
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneFABG, ATU5465
    Organism ScientificAGROBACTERIUM FABRUM
    Organism Taxid176299
    StrainC58 / ATCC 33970

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
2UNL1Ligand/IonUNKNOWN LIGAND
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1NAP4Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
2UNL2Ligand/IonUNKNOWN LIGAND

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:18 , SER A:20 , ARG A:21 , GLY A:22 , ILE A:23 , HIS A:41 , VAL A:43 , SER A:47 , GLY A:67 , ASP A:68 , LEU A:69 , ASN A:94 , ALA A:95 , SER A:96 , ILE A:144 , GLY A:145 , TYR A:159 , LYS A:163 , PRO A:189 , GLY A:190 , VAL A:192 , THR A:194 , ARG A:196 , HOH A:404 , HOH A:439 , HOH A:455 , HOH A:500 , HOH A:574 , HOH B:482BINDING SITE FOR RESIDUE NAP A 300
2AC2SOFTWAREGLY B:18 , SER B:20 , ARG B:21 , GLY B:22 , ILE B:23 , HIS B:41 , GLY B:42 , VAL B:43 , SER B:47 , GLY B:67 , ASP B:68 , LEU B:69 , ASN B:94 , ALA B:95 , SER B:96 , ILE B:144 , GLY B:145 , TYR B:159 , LYS B:163 , PRO B:189 , GLY B:190 , VAL B:192 , THR B:194 , ARG B:196 , HOH B:401 , HOH B:430 , HOH B:484 , HOH B:492 , HOH B:548 , HOH B:559 , HOH B:577 , HOH B:589BINDING SITE FOR RESIDUE NAP B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4IMR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4IMR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4IMR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4IMR)

(-) Exons   (0, 0)

(no "Exon" information available for 4IMR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:258
                                                                                                                                                                                                                                                                                                  
               SCOP domains d4imra_ A: automated matches                                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhh....eeee....hhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4imr A  -4 LYFQSMRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVKPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY 253
                                     5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245        

Chain B from PDB  Type:PROTEIN  Length:253
                                                                                                                                                                                                                                                                                             
               SCOP domains d4imrb_ B: automated matches                                                                                                                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh....eeee....hhhhhhhhhhhhhh..eeee.......hhhhhhhhhhh...eee........hhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4imr B   1 MRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVKPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY 253
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4IMR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4IMR)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4imr)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4imr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9CL57_AGRFC | A9CL57
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A9CL57_AGRFC | A9CL57
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4IMR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4IMR)