Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  ZEBRAFISH CHEMOKINE CXL1
 
Authors :  D. Rajasekaran, C. Fan, W. Meng, J. W. Pflugrath, E. J. Lolis
Date :  03 Oct 12  (Deposition) - 21 Aug 13  (Release) - 23 Apr 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.62
Chains :  Asym./Biol. Unit :  A
Keywords :  Chemokine Fold, Chemotaxis, New Chemokine Family, Zebrafish Fish Chemokine Structure, Cxcl1A, Sulfur-Sad, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Rajasekaran, C. Fan, W. Meng, J. W. Pflugrath, E. J. Lolis
Structural Insight Into The Evolution Of A New Chemokine Family From Zebrafish.
Proteins V. 82 708 2014
PubMed-ID: 23900850  |  Reference-DOI: 10.1002/PROT.24380

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemPICHIA
    Expression System Taxid4919
    Organism CommonLEOPARD DANIO,ZEBRA DANIO,ZEBRA FISH
    Organism ScientificDANIO RERIO
    Organism Taxid7955

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4HED)

(-) Sites  (0, 0)

(no "Site" information available for 4HED)

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:15 -A:40
2A:31 -A:77
3A:43 -A:55

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4HED)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4HED)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4HED)

(-) Exons   (0, 0)

(no "Exon" information available for 4HED)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:70
                                                                                                     
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeeee........eeeeee....eeee.....hhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  4hed A 12 PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCRGEA 81
                                    21        31        41        51        61        71        81

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4HED)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4HED)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4HED)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4hed)
 
  Sites
(no "Sites" information available for 4hed)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4hed)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4hed
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F1Q6N2_DANRE | F1Q6N2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  F1Q6N2_DANRE | F1Q6N2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        F1Q6N2_DANRE | F1Q6N24hcs

(-) Related Entries Specified in the PDB File

4hcs