Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF THE ARCHAEOGLOBUS FULGIDUS METHENYL-TETRAHYDROMETHANOPTERIN CYCLOHYDROLASE IN COMPLEX WITH TETRAHYDROMETHANPTERIN
 
Authors :  V. Upadhyay, U. Demmer, E. Warkentin, J. Moll, S. Shima, U. Ermler
Date :  31 Aug 12  (Deposition) - 31 Oct 12  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.30
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Tetrahydromethanopterin, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  V. Upadhyay, U. Demmer, E. Warkentin, J. Moll, S. Shima, U. Ermler
Structure And Catalytic Mechanism Of N(5), N(10)-Methenyl-Tetrahydromethanopterin Cyclohydrolase.
Biochemistry V. 51 8435 2012
PubMed-ID: 23013430  |  Reference-DOI: 10.1021/BI300777K

(-) Compounds

Molecule 1 - METHENYLTETRAHYDROMETHANOPTERIN CYCLOHYDROLASE
    ChainsA, B, C
    EC Number3.5.4.27
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-24A(+)
    Expression System StrainROSETTA (DE3) PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneAF_1935, MCH
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid224325
    StrainDSM 4304
    SynonymMETHENYL-H4MPT CYCLOHYDROLASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1N4M2Ligand/Ion1-[4-({(1R)-1-[(6S,7S)-2-AMINO-7-METHYL-4-OXO-1,4,5,6,7,8-HEXAHYDROPTERIDIN-6-YL]ETHYL}AMINO)PHENYL]-1-DEOXY-5-O-{5-O-[(R)-{[(1R)-1,3-DICARBOXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]-ALPHA-D-RIBOFURANOSYL}-D-XYLITOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:94 , ALA A:95 , GLY A:96 , MET A:107 , GLU A:140 , ILE A:180 , ARG A:183 , GLU A:186 , THR A:187 , MET A:222 , ASN A:226 , MET A:229 , PHE A:272 , PHE A:280 , HOH A:807BINDING SITE FOR RESIDUE N4M A 401
2AC2SOFTWARELYS B:94 , ALA B:95 , GLY B:96 , MET B:107 , GLU B:140 , ILE B:180 , ARG B:183 , GLU B:186 , THR B:187 , MET B:222 , ASN B:226 , MET B:229 , PHE B:272 , PHE B:280 , HOH B:556BINDING SITE FOR RESIDUE N4M B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GVQ)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Lys A:118 -Pro A:119
2Lys B:118 -Pro B:119
3Lys C:118 -Pro C:119

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GVQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GVQ)

(-) Exons   (0, 0)

(no "Exon" information available for 4GVQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:315
                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains d4gvqa_ A: automated matches                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh.eeee.....eeee.......hhhhhhhhhhhhh...eeeeeeeeee..eeeeeeeeee.hhhhhhh......eeeee..eeeeee..hhhhhh.hhhhhhhhh.......eeeeee.....hhhhhhhhhhhhh.hhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeeee......hhhhhhhhhhhhhhhhheeeeee...hhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhh...eeeeee.....eeeee..hhhhhhhhh.ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gvq A   1 MLSVNEIAAEIVEDMLDYEEELRIESKKLENGAIVVDCGVNVPGSYDAGIMYTQVCMGGLADVDIVVDTINDVPFAFVTEYTDHPAIACLGSQKAGWQIKVDKYFAMGSGPARALALKPKKTYERIEYEDDADVAVIALEANQLPDEKVMEFIAKECDVDPENVYALVAPTASIVGSVQISGRIVETAIFKMNEIGYDPKLIVSGAGRCPISPILENDLKAMGSTNDSMMYYGSVFLTVKKYDEILKNVPSCTSRDYGKPFYEIFKAANYDFYKIDPNLFAPAQIAVNDLETGKTYVHGKLNAEVLFQSYQIVLE 315
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310     

Chain B from PDB  Type:PROTEIN  Length:315
                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains d4gvqb_ B: automated matches                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh.eeee.....eeee.......hhhhhhhhhhhhh...eeeeeeeeee..eeeeeeeeee.hhhhhhh......eeeee..eeeeee..hhhhhh.hhhhhhhhh.......eeeeee.....hhhhhhhhhhhhh.hhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeeee......hhhhhhhhhhhhhhhhheeeeee...hhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhh...eeeeee.....eeeee..hhhhhhhhh.ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gvq B   1 MLSVNEIAAEIVEDMLDYEEELRIESKKLENGAIVVDCGVNVPGSYDAGIMYTQVCMGGLADVDIVVDTINDVPFAFVTEYTDHPAIACLGSQKAGWQIKVDKYFAMGSGPARALALKPKKTYERIEYEDDADVAVIALEANQLPDEKVMEFIAKECDVDPENVYALVAPTASIVGSVQISGRIVETAIFKMNEIGYDPKLIVSGAGRCPISPILENDLKAMGSTNDSMMYYGSVFLTVKKYDEILKNVPSCTSRDYGKPFYEIFKAANYDFYKIDPNLFAPAQIAVNDLETGKTYVHGKLNAEVLFQSYQIVLE 315
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310     

Chain C from PDB  Type:PROTEIN  Length:315
                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains d4gvqc_ C: automated matches                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh.eeee.....eeee.......hhhhhhhhhhhhh...eeeeeeeeee..eeeeeeeeee.hhhhhhh......eeeee..eeeeee..hhhhhh.hhhhhhhhh.......eeeeee.....hhhhhhhhhhhhh.hhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeeee......hhhhhhhhhhhhhhhhheeeeee...hhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhh...eeeeee.....eeeee..hhhhhhhhh.ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gvq C   1 MLSVNEIAAEIVEDMLDYEEELRIESKKLENGAIVVDCGVNVPGSYDAGIMYTQVCMGGLADVDIVVDTINDVPFAFVTEYTDHPAIACLGSQKAGWQIKVDKYFAMGSGPARALALKPKKTYERIEYEDDADVAVIALEANQLPDEKVMEFIAKECDVDPENVYALVAPTASIVGSVQISGRIVETAIFKMNEIGYDPKLIVSGAGRCPISPILENDLKAMGSTNDSMMYYGSVFLTVKKYDEILKNVPSCTSRDYGKPFYEIFKAANYDFYKIDPNLFAPAQIAVNDLETGKTYVHGKLNAEVLFQSYQIVLE 315
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GVQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GVQ)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    N4M  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys A:118 - Pro A:119   [ RasMol ]  
    Lys B:118 - Pro B:119   [ RasMol ]  
    Lys C:118 - Pro C:119   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gvq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MCH_ARCFU | O28344
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.4.27
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MCH_ARCFU | O28344
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MCH_ARCFU | O283444gvr 4gvs

(-) Related Entries Specified in the PDB File

4gvr 4gvs