Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CROTONYL-COA CARBOXYLASE/REDUCTASE
 
Authors :  S. Weidenweber, T. J. Erb, U. Ermler
Date :  08 Aug 12  (Deposition) - 14 Aug 13  (Release) - 14 Aug 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  B  (2x)
Keywords :  Rossmann Fold, Reductive Carboxylation, Nadph, Dehydrogenase/Reductase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Weidenweber, T. J. Erb, U. Ermler
Crotonyl-Coa Carboxylase/Reductase
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CROTONYL-COA CARBOXYLASE/REDUCTASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET23-B
    Expression System StrainROSETTA
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCCR
    Organism ScientificMETHYLOBACTERIUM EXTORQUENS
    Organism Taxid272630
    StrainAM1
    SynonymCCR

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)A 
Biological Unit 2 (2x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1MG1Ligand/IonMAGNESIUM ION
2NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:76 , ASN A:77 , CYS A:188 , ASN A:405BINDING SITE FOR RESIDUE MG A 501
2AC2SOFTWARETYR A:78 , TRP A:82 , THR A:195 , GLY A:218 , SER A:220 , GLY A:221 , GLY A:222 , LEU A:223 , VAL A:241 , ILE A:242 , SER A:243 , LYS A:247 , ARG A:262 , CYS A:331 , ALA A:332 , THR A:334 , THR A:335 , TRP A:347 , HIS A:357 , PHE A:358 , HIS A:401BINDING SITE FOR RESIDUE NAP A 502
3AC3SOFTWARETYR B:78 , TRP B:82 , THR B:195 , TRP B:217 , GLY B:218 , SER B:220 , GLY B:221 , GLY B:222 , LEU B:223 , ILE B:242 , SER B:243 , LYS B:247 , ARG B:262 , CYS B:331 , ALA B:332 , THR B:334 , THR B:335 , TRP B:347 , HIS B:357 , PHE B:358 , HIS B:401BINDING SITE FOR RESIDUE NAP B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GI2)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Glu A:87 -Pro A:88
2Ala A:204 -Pro A:205
3Glu B:87 -Pro B:88
4Ala B:204 -Pro B:205

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GI2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GI2)

(-) Exons   (0, 0)

(no "Exon" information available for 4GI2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:428
                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........................eeeeeee......hhhhhheeeeee.......eeeeeeeeee..hhhhhhhhh...hhhhh.....ee....eeeeeeee...........eeee..ee.....hhhhh.hhhhh...ee............eeeee...eee.....hhhhhh.hhhhhhhhhhhhhh..........eeee......hhhhhhhhhhh...eeeeee...hhhhhhhh.....eee.hhh..........hhhhhhhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhhhheeeeeeeee...........hhhhhhhh..eeee....hhhhhhhhhhhhhh......eeeeehhhhhhhhhhhhhh......eeeee.........hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gi2 A   7 PAWTGQTAEAKDLYELGEIPPLGHVPAKMYAWAIRRERHGPPEQSHQLEVLPVWEIGDDEVLVYVMAAGVNYNGVWAGLGEPISPFDVHKGEYHIAGSDASGIVWKVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPTQRIWGYETGDGSFAQFCRVQSRQLMARPKHLTWEEAACYTLTLATAYRMLFGHAPHTVRPGQNVLIWGASGGLGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKDFDCWGQLPTVNSPEYNTWLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVAKRGGMIVFCAGTTGFNITFDARYVWMRQKRIQGSHFAHLKQASAANQFVMDRRVDPCMSEVFPWDKIPAAHTKMWKNQHPPGNMAVLVNSTRAGLRTVEDVIEAGPLKAMAA 434
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426        

Chain B from PDB  Type:PROTEIN  Length:426
                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........................eeeeeee......hhhhhheeeeee.......eeeeeeeeee..hhhhhhhhh...hhhhh.....ee....eeeeeeee...........eeee..ee.....hhhhh.hhhhh...ee............eeeee...eee.....hhhhhh.hhhhhhhhhhhhhh..........eeee......hhhhhhhhhhh...eeeeee...hhhhhhhh.....eee.hhh..........hhhhhhhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhhhheeeeeeeee...........hhhhhhhh..eeee....hhhhhhhhhhhhhh......eeeeehhhhhhhhhhhhhh......eeeee.........hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4gi2 B   9 WTGQTAEAKDLYELGEIPPLGHVPAKMYAWAIRRERHGPPEQSHQLEVLPVWEIGDDEVLVYVMAAGVNYNGVWAGLGEPISPFDVHKGEYHIAGSDASGIVWKVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPTQRIWGYETGDGSFAQFCRVQSRQLMARPKHLTWEEAACYTLTLATAYRMLFGHAPHTVRPGQNVLIWGASGGLGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKDFDCWGQLPTVNSPEYNTWLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVAKRGGMIVFCAGTTGFNITFDARYVWMRQKRIQGSHFAHLKQASAANQFVMDRRVDPCMSEVFPWDKIPAAHTKMWKNQHPPGNMAVLVNSTRAGLRTVEDVIEAGPLKAMAA 434
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4GI2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GI2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GI2)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:204 - Pro A:205   [ RasMol ]  
    Ala B:204 - Pro B:205   [ RasMol ]  
    Glu A:87 - Pro A:88   [ RasMol ]  
    Glu B:87 - Pro B:88   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gi2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C5AP81_METEA | C5AP81
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  C5AP81_METEA | C5AP81
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4GI2)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4GI2)