Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN ALPHA-BISABOLOL SYNTHASE MUTANT
 
Authors :  J. Li, Z. Peng
Date :  26 Jul 12  (Deposition) - 13 Mar 13  (Release) - 01 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym./Biol. Unit :  A
Keywords :  Sesquiterpene Synthase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. X. Li, X. Fang, Q. Zhao, J. X. Ruan, C. Q. Yang, L. J. Wang, D. J. Miller, J. A. Faraldos, R. K. Allemann, X. Y. Chen, P. Zhang
Rational Engineering Of Plasticity Residues Of Sesquiterpen Synthases From Artemisia Annua: Product Specificity And Catalytic Efficiency.
Biochem. J. V. 451 417 2013
PubMed-ID: 23438177  |  Reference-DOI: 10.1042/BJ20130041

(-) Compounds

Molecule 1 - AMORPHA-4,11-DIENE SYNTHASE
    ChainsA
    EC Number4.2.3.24
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePET-28B
    GeneAABOS, AMS1, KCS12
    Organism CommonSWEET ANNIE
    Organism ScientificARTEMISIA ANNUA
    Organism Taxid35608

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4GAX)

(-) Sites  (0, 0)

(no "Site" information available for 4GAX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GAX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4GAX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GAX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GAX)

(-) Exons   (0, 0)

(no "Exon" information available for 4GAX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:525
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains d4gaxa1 A:13-218 automated matches                                                                                                                                                                            d4gaxa2 A:219-546 automated matches                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4gax A  13 ANFSPSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGARSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRNLMVEAQWANEGHIPTTEELDSVAVITGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAAKDAFTAMGEEYKNLVKSLLVYPMSI 546
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442     ||461       471       481       491       501       511       521       531       541     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                             448|                                                                                        
                                                                                                                                                                                                                                                                                                                                                                                                                                                                              458                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GAX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GAX)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4gax)
 
  Sites
(no "Sites" information available for 4gax)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4gax)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4gax
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  M4GGS1_ARTAN | M4GGS1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.2.3.24
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  M4GGS1_ARTAN | M4GGS1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4GAX)

(-) Related Entries Specified in the PDB File

4fjq WILD TYPE