Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MOUSE NGF IN COMPLEX WITH LYSO-PS
 
Authors :  T. Jiang, Q. Tong
Date :  23 Mar 12  (Deposition) - 12 Sep 12  (Release) - 12 Sep 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Lyso-Ps, Phospholipid, Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Q. Tong, F. Wang, H. Z. Zhou, H. L. Sun, H. Song, Y. Y. Shu, Y. Gong, W. T. Zhang, T. X. Cai, F. Q. Yang, J. Tang, T. Jiang
Structural And Functional Insights Into Lipid-Bound Nerve Growth Factors
Faseb J. V. 26 3811 2012
PubMed-ID: 22649032  |  Reference-DOI: 10.1096/FJ.12-207316

(-) Compounds

Molecule 1 - BETA-NERVE GROWTH FACTOR
    ChainsA, B, C, D
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymBETA-NGF

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1S122Ligand/IonO-[(S)-HYDROXY{[(2S)-2-HYDROXY-3-(OCTADEC-9-ENOYLOXY)PROPYL]OXY}PHOSPHORYL]-L-SERINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1S121Ligand/IonO-[(S)-HYDROXY{[(2S)-2-HYDROXY-3-(OCTADEC-9-ENOYLOXY)PROPYL]OXY}PHOSPHORYL]-L-SERINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1S121Ligand/IonO-[(S)-HYDROXY{[(2S)-2-HYDROXY-3-(OCTADEC-9-ENOYLOXY)PROPYL]OXY}PHOSPHORYL]-L-SERINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:45 , LYS A:88 , TRP A:99 , ASN B:45 , VAL B:48 , PHE B:49 , ARG B:50 , TYR B:52 , LYS B:88 , TRP B:99 , HOH B:304BINDING SITE FOR RESIDUE S12 B 201
2AC2SOFTWAREGLY B:10 , LYS C:88 , TRP C:99 , ILE D:44 , ASN D:45 , VAL D:48 , PHE D:49 , ARG D:50 , LYS D:88 , TRP D:99 , HOH D:307BINDING SITE FOR RESIDUE S12 D 201

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:15 -A:80
2A:58 -A:108
3A:68 -A:110
4B:15 -B:80
5B:58 -B:108
6B:68 -B:110
7C:15 -C:80
8C:58 -C:108
9C:68 -C:110
10D:15 -D:80
11D:58 -D:108
12D:68 -D:110

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4EAX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4EAX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4EAX)

(-) Exons   (0, 0)

(no "Exon" information available for 4EAX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:108
                                                                                                                                            
               SCOP domains d4eaxa_ A: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee...eeeeee....eee.....eeee..eeee..eeee..eeeeee.................eee..eeeeeeeeeeee....eeeeeeeeeeeee.eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 4eax A  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 117
                                    19        29        39        49        59        69        79        89        99       109        

Chain B from PDB  Type:PROTEIN  Length:108
                                                                                                                                            
               SCOP domains d4eaxb_ B: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee...eeeeee....eee.....eeee..eee....eee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 4eax B  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 117
                                    19        29        39        49        59        69        79        89        99       109        

Chain C from PDB  Type:PROTEIN  Length:108
                                                                                                                                            
               SCOP domains d4eaxc_ C: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee...eeeeee....eee.....eeee..eeee..eeee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 4eax C  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 117
                                    19        29        39        49        59        69        79        89        99       109        

Chain D from PDB  Type:PROTEIN  Length:108
                                                                                                                                            
               SCOP domains d4eaxd_ D: automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeee....eee.....eeee..eeee..eeee..eeeeee.................eeeeeeeeeeeeeeeee....eeeeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 4eax D  10 GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKAT 117
                                    19        29        39        49        59        69        79        89        99       109        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4EAX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4EAX)

(-) Gene Ontology  (38, 38)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    S12  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4eax)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4eax
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NGF_MOUSE | P01139
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NGF_MOUSE | P01139
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NGF_MOUSE | P011391bet 1btg 1sgf 3ij2 4xpj 5lsd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4EAX)