Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  PRECORRIN-4 C(11)-METHYLTRANSFERASE FROM CLOSTRIDIUM DIFFICILE
 
Authors :  J. Osipiuk, B. Nocek, M. Makowska-Grzyska, L. Papazisi, W. F. Anderson A. Joachimiak, Center For Structural Genomics Of Infectious D (Csgid)
Date :  05 Mar 12  (Deposition) - 14 Mar 12  (Release) - 14 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.49
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Osipiuk, B. Nocek, M. Makowska-Grzyska, L. Papazisi, W. F. Anderson, A. Joachimiak
Precorrin-4 C(11)-Methyltransferase From Clostridium Difficile
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PRECORRIN-4 C(11)-METHYLTRANSFERASE
    ChainsA
    EC Number2.1.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneCBIF, CD630_34260
    Organism ScientificCLOSTRIDIUM DIFFICILE
    Organism Taxid272563
    Strain630
    SynonymPRECORRIN-3 METHYLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4E16)

(-) Sites  (0, 0)

(no "Site" information available for 4E16)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4E16)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4E16)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4E16)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4E16)

(-) Exons   (0, 0)

(no "Exon" information available for 4E16)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with Q180S3_PEPD6 | Q180S3 from UniProtKB/TrEMBL  Length:250

    Alignment length:232
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230  
         Q180S3_PEPD6     1 MNKVHFVGAGPGDKELITLKGYKLLSNADVVIYAGSLVNPELLEYCKEDCQIHNSAHMDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRMEGRTPVPEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGE 232
               SCOP domains d4e16a_ A: automated matches                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....hhhhhhhhhhhhhhhh.eeee.....hhhhhhhh....eeee.hhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhh..eeee...hhhhhhhhhhh...........eeeee.---...hhhhhhhhhhh...eeeeee...hhhhhhhhhhhh......eeeeee.......eeeeee..hhhhhhhhh.....eeeee.hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4e16 A   1 MNKVHFVGAGPGDKELITLKGYKLLSNADVVIYAGSLVNPELLEYCKEDCQIHNSAHMDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRM---TPVPEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGE 232
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        |-  |    150       160       170       180       190       200       210       220       230  
                                                                                                                                                                    139 143                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4E16)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4E16)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q180S3_PEPD6 | Q180S3)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0046026    precorrin-4 C11-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + precorrin-4 = S-adenosyl-L-homocysteine + precorrin 5.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009236    cobalamin biosynthetic process    The chemical reactions and pathways resulting in the formation of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4e16)
 
  Sites
(no "Sites" information available for 4e16)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4e16)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4e16
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q180S3_PEPD6 | Q180S3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q180S3_PEPD6 | Q180S3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4E16)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4E16)