Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DROSOPHILA MELANOGASTER DJ-1BETA
 
Authors :  J. Lin, J. Prahlad, M. A. Wilson
Date :  02 Mar 12  (Deposition) - 21 Mar 12  (Release) - 20 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Flavodoxin-Like Fold, Stress Response, Motor Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Lin, J. Prahlad, M. A. Wilson
Conservation Of Oxidative Protein Stabilization In An Insec Homologue Of Parkinsonism-Associated Protein Dj-1.
Biochemistry V. 51 3799 2012
PubMed-ID: 22515803  |  Reference-DOI: 10.1021/BI3003296

(-) Compounds

Molecule 1 - DJ-1 BETA
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCG1349, DJ-1 BETA, DJ-1-BETA, DJ-1BETA, DMEL_CG1349
    Organism CommonFRUIT FLY
    Organism ScientificDROSOPHILA MELANOGASTER
    Organism Taxid7227
    SynonymDJ-1BETA, GH09983P

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:59 , GLN A:130 , ASN A:133 , HOH A:356 , HOH A:373BINDING SITE FOR RESIDUE SO4 A 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4E08)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4E08)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4E08)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4E08)

(-) Exons   (0, 0)

(no "Exon" information available for 4E08)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:186
 aligned with DJ1B_DROME | Q9VA37 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      
           DJ1B_DROME     1 MSKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186
               SCOP domains d4e08a_ A: automated matches                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhhhhh..eeeeee......ee.....eee..ee.hhhh.....eeee..hhhhhhhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhh......ee..hhhhhhhh....ee.....eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4e08 A   1 MSKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

Chain B from PDB  Type:PROTEIN  Length:186
 aligned with DJ1B_DROME | Q9VA37 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      
           DJ1B_DROME     1 MSKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186
               SCOP domains d4e08b_ B: automated matches                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhhhhh..eeeeee......ee.....eee..ee.hhhh.....eeee..hhhhhhhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhh......ee..hhhhhhhhh...ee.....eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4e08 B   1 MSKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4E08)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4E08)

(-) Gene Ontology  (14, 21)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (DJ1B_DROME | Q9VA37)
molecular function
    GO:0019172    glyoxalase III activity    Catalysis of the reaction: methylglyoxal + H2O = D-lactate.
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
biological process
    GO:0008344    adult locomotory behavior    Locomotory behavior in a fully developed and mature organism.
    GO:0070301    cellular response to hydrogen peroxide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
    GO:0019249    lactate biosynthetic process    The chemical reactions and pathways resulting in the formation of lactate, the anion of lactic acid.
    GO:0019243    methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione    The chemical reactions and pathways resulting in the breakdown of methylglyoxal, CH3-CO-CHO, into D-lactate via the intermediate S-lactoyl-glutathione. Glutathione is used in the first step of the pathway and then regenerated in the second step.
    GO:0042775    mitochondrial ATP synthesis coupled electron transport    The transfer of electrons through a series of electron donors and acceptors, generating energy that is ultimately used for synthesis of ATP, as it occurs in the mitochondrial inner membrane or chloroplast thylakoid membrane.
    GO:0048640    negative regulation of developmental growth    Any process that stops, prevents, or reduces the frequency, rate or extent of developmental growth.
    GO:0046626    regulation of insulin receptor signaling pathway    Any process that modulates the frequency, rate or extent of insulin receptor signaling.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006979    response to oxidative stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4e08)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4e08
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DJ1B_DROME | Q9VA37
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DJ1B_DROME | Q9VA37
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4E08)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4E08)