Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF EDITOSOME PROTEIN
 
Authors :  Y. -J. Park, W. Hol
Date :  03 Feb 12  (Deposition) - 04 Jul 12  (Release) - 18 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Krepa1, Vhh, Single Domain Antibody, Protein Binding, Rna Binding Protein-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. J. Park, T. Budiarto, M. Wu, E. Pardon, J. Steyaert, W. G. Hol
The Structure Of The C-Terminal Domain Of The Largest Editosome Interaction Protein And Its Role In Promoting Rna Binding By Rna-Editing Ligase L2.
Nucleic Acids Res. V. 40 6966 2012
PubMed-ID: 22561373  |  Reference-DOI: 10.1093/NAR/GKS369

(-) Compounds

Molecule 1 - SINGLE DOMAIN ANTIBODY VHH
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PRSF
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Common: LLAMA
    Organism Scientific: LAMA GLAMA
    Organism Taxid: 9844
 
Molecule 2 - RNA-EDITING COMPLEX PROTEIN MP81
    Chains: C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PRSF
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organism Scientific: TRYPANOSOMA BRUCEI
    Organism Taxid: 5691

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A  D
Biological Unit 2 (1x):  BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4DK6)

(-) Sites  (0, 0)

(no "Site" information available for 4DK6)

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:22 -A:96
2B:22 -B:96

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4DK6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4DK6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4DK6)

(-) Exons   (0, 0)

(no "Exon" information available for 4DK6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:127
                                                                                                                                                               
               SCOP domains d4dk6a_ A: automated matches                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeee....eeeeeeeee.hhhh..eeeeee......eeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeee........ee.hhhhh.ee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dk6 A   1 QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       


Chain B from PDB  Type:PROTEIN  Length:127
                                                                                                                                                               
               SCOP domains d4dk6b_ B: automated matches                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...eee....eeeeeeeee.hhhh..eeeeee......eeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeee........ee.hhhhh.ee...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dk6 B   1 QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS 127
                                    10        20        30        40        50        60        70        80        90       100       110       120       


Chain C from PDB  Type:PROTEIN  Length:87
 aligned with Q95W15_9TRYP | Q95W15 from UniProtKB/TrEMBL  Length:762

    Alignment length:135
                                   636       646       656       666       676       686       696       706       716       726       736       746       756     
         Q95W15_9TRYP   627 SNALMIGRIADVQHGFLGAMTVTQYVLEVDGDERINSKGVTTPASACTPDPASTKAVEAKGEEGEVVEPEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGYVKVV 761
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeeee..eeeeeeeeee..--------------------------------------..eeeeeeee.---------.......eeeeeeeee..eee......eee..eeee.-...eeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dk6 C 627 SNALMIGRIADVQHGFLGAMTVTQYVLEVDG--------------------------------------EKEFIVIRCMG---------DQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVV-PLGYVKVV 761
                                   636       646       656|        -         -         -       696       706       716       726       736       746     | 756     
                                                        657                                    696       706       716                                 752 |       
                                                                                                                                                         754       


Chain D from PDB  Type:PROTEIN  Length:82
 aligned with Q95W15_9TRYP | Q95W15 from UniProtKB/TrEMBL  Length:762

    Alignment length:136
                                   636       646       656       666       676       686       696       706       716       726       736       746       756      
         Q95W15_9TRYP   627 SNALMIGRIADVQHGFLGAMTVTQYVLEVDGDERINSKGVTTPASACTPDPASTKAVEAKGEEGEVVEPEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGYVKVVG 762
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee...eeeee..eeeeeeeee.-----------------------------------------..eeeeee.-----------......eeeeeeeee..eee......eee..eeeee--.eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dk6 D 627 SNALMIGRIADVQHGFLGAMTVTQYVLEV-----------------------------------------KEFIVIRCM-----------QVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVV--LGYVKVVG 762
                                   636       646        |-         -         -         -         -|       |-         -|      726       736       746     | 756      
                                                      655                                       697     705         717                                752  |       
                                                                                                                                                          755
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DK6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DK6)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain C,D   (Q95W15_9TRYP | Q95W15)
molecular function
    GO:0045294    alpha-catenin binding    Interacting selectively and non-covalently with the alpha subunit of the catenin complex.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0070706    RNA nucleotide deletion    The modification of an RNA molecule by removal of a single nucleotide.
    GO:0070705    RNA nucleotide insertion    The modification of an RNA molecule by insertion of one or more nucleotides.
    GO:1900864    mitochondrial RNA modification    Any RNA modification that takes place in mitochondrion.
cellular component
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4dk6)
 
  Sites
(no "Sites" information available for 4dk6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4dk6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4dk6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q95W15_9TRYP | Q95W15
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q95W15_9TRYP | Q95W15
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q95W15_9TRYP | Q95W15: 4dk3 4dka

(-) Related Entries Specified in the PDB File

4dk3 4dka