Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PSTA
 
Authors :  I. Campeotto, P. Freemont, A. Grundling
Date :  22 Oct 14  (Deposition) - 24 Dec 14  (Release) - 11 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Signalling Protein, Signalling Protein, Gram-Positive, C-Di-Amp (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Campeotto, Y. Zhang, M. G. Mladenov, P. S. Freemont, A. Grundling
Complex Structure And Biochemical Characterization Of The Staphylococcus Aureus Cyclic Di-Amp Binding Protein Psta, The Founding Member Of A New Signal Transduction Protein Family
J. Biol. Chem. V. 290 2888 2015
PubMed-ID: 25505271  |  Reference-DOI: 10.1074/JBC.M114.621789

(-) Compounds

Molecule 1 - PSTA
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 1280

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
12BA3Ligand/Ion(2R,3R,3AS,5R,7AR,9R,10R,10AS,12R,14AR)-2,9-BIS(6-AMINO-9H-PURIN-9-YL)OCTAHYDRO-2H,7H-DIFURO[3,2-D:3',2'-J][1,3,7,9,2,8]TETRAOXADIPHOSPHACYCLODODECINE-3,5,10,12-TETROL 5,12-DIOXIDE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:-3 , ASN A:24 , ARG A:26 , ALA A:27 , THR A:28 , LEU A:45 , GLY A:47 , SER A:72 , GLN A:108 , HOH A:2030 , HOH A:2032 , HOH A:2035 , HOH A:2037 , HOH A:2074 , HOH A:2076 , HOH A:2078 , HOH A:2079 , ILE B:7 , GLY B:34 , GLY B:35 , PHE B:36 , LEU B:37 , ASN B:41 , GLU B:92 , THR B:97 , PHE B:99BINDING SITE FOR RESIDUE 2BA A 110
2AC2SOFTWAREASN B:24 , ARG B:26 , ALA B:27 , THR B:28 , LEU B:45 , GLY B:47 , GLN B:108 , HOH B:2021 , HOH B:2023 , HOH B:2024 , HOH B:2044 , HOH B:2045 , HOH B:2046 , HOH B:2048 , HOH B:2049 , HOH B:2050 , ARG C:-3 , GLY C:34 , GLY C:35 , PHE C:36 , LEU C:37 , ASN C:41 , VAL C:91 , GLU C:92 , GLY C:94 , THR C:97BINDING SITE FOR RESIDUE 2BA B 110
3AC3SOFTWAREILE A:7 , GLY A:34 , GLY A:35 , PHE A:36 , LEU A:37 , ASN A:41 , THR A:97 , PHE A:99 , HOH A:2043 , HOH A:2045 , ARG B:-3 , HOH B:2003 , ASN C:24 , ARG C:26 , ALA C:27 , THR C:28 , LEU C:45 , GLY C:47 , GLN C:108 , HOH C:2020 , HOH C:2023 , HOH C:2043 , HOH C:2044 , HOH C:2045BINDING SITE FOR RESIDUE 2BA C 110

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4D3H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4D3H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4D3H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4D3H)

(-) Exons   (0, 0)

(no "Exon" information available for 4D3H)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhh....eeeeeee.................hhhhhhhhhhhhhh.eeeee..eeeee...........eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 4d3h A  -8 SGLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPVEVEVGGATVFVMPVDAFHQF 109
                                     1        11        21        31        41        51        61        71||      96       106   
                                                                                                           72|                     
                                                                                                            88                     


Chain B from PDB  Type:PROTEIN  Length:104
                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeehhhhhhhhhhhhhhh....eeeeeee.....eeeeeeeeee..hhhhhhhhhhhhhh.eeeee....eeeee..eeeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 4d3h B  -7 GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPIPVEVEVGGATVFVMPVDAFHQF 109
                                     2        12        22        32        42        52        62        72 ||     95       105    
                                                                                                            74|                     
                                                                                                             88                     


Chain C from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhh....eeeeeee.................hhhhhhhhhhhhhh...ee....ee................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 4d3h C  -8 SGLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPVEVGGATVFVMPVDAFHQF 109
                                     1        11        21        31        41        51        61        71 ||     98       108 
                                                                                                            73|                  
                                                                                                             91
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4D3H)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4D3H)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4D3H)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4D3H)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2BA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4d3h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4d3h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2G229_STAA8 | Q2G229
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q2G229_STAA8 | Q2G229
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q2G229_STAA8 | Q2G229: 4d3g

(-) Related Entries Specified in the PDB File

4d3g STRUCTURE OF PSTA