Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  3D EM MAP OF THE SODIUM PROTON ANTIPORTER MJNHAP1 FROM METHANOCALDOCOCCUS JANNASCHII
 
Authors :  C. Paulino, D. Woehlert, O. Yildiz, W. Kuhlbrandt
Date :  25 Apr 14  (Deposition) - 10 Dec 14  (Release) - 10 Dec 14  (Revision)
Method :  ELECTRON CRYSTALLOGRAPHY
Resolution :  6.00
Chains :  Asym. Unit :  B
Biol. Unit 1:  B  (2x)
Keywords :  Transport Protein, Membrane Protein, Antiporter, Transporter, Exchanger, Cpa (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Paulino, D. Woehlert, O. Yildiz, W. Kuhlbrandt
3D Em Map Of The Sodium Proton Antiporter Mjnhap1 From Methanocaldococcus Jannaschii
Elife V. 3 2014
PubMed-ID: 25426803  |  Reference-DOI: 10.7554/ELIFE.03583

(-) Compounds

Molecule 1 - NA(+)/H(+) ANTIPORTER 1
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET26B
    Expression System Vector Type: PLASMID
    Organism Scientific: METHANOCALDOCOCCUS JANNASCHII DSM 2661
    Organism Taxid: 243232
    Synonym: MJNHAP1

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : B
Biological Unit 1 (2x): B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4D0A)

(-) Sites  (0, 0)

(no "Site" information available for 4D0A)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4D0A)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Thr B:145 -Asn B:146
2Ile B:377 -Thr B:378

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4D0A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4D0A)

(-) Exons   (0, 0)

(no "Exon" information available for 4D0A)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain B from PDB  Type:PROTEIN  Length:419
 aligned with NAH1_METJA | Q60362 from UniProtKB/Swiss-Prot  Length:426

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           NAH1_METJA     1 MELMMAIGYLGLALVLGSLVAKIAEKLKIPDIPLLLLLGLIIGPFLQIIPSDSAMEIFEYAGPIGLIFILLGGAFTMRISLLKRVIKTVVRLDTITFLITLLISGFIFNMVLNLPYTSPVGYLFGAITAATDPATLIPVFSRVRTNPEVAITLEAESIFNDPLGIVSTSVILGLFGLFSSSNPLIDLITLAGGAIVVGLLLAKIYEKIIIHCDFHEYVAPLVLGGAMLLLYVGDDLLPSICGYGFSGYMAVAIMGLYLGDALFRADDIDYKYIVSFCDDLSLLARVFIFVFLGACIKLSMLENYFIPGLLVALGSIFLARPLGVFLGLIGSKHSFKEKLYFALEGPRGVVPAALAVTVGIEILKNADKIPASITKYITPTDIAGTIIIGTFMTILLSVILEASWAGMLALKLLGEYKPK 419
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh......hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4d0a B   1 MELMMAIGYLGLALVLGSLVAKIAEKLKIPDIPLLLLLGLIIGPFLQIIPSDSAMEIFEYAGPIGLIFILLGGAFTMRISLLKRVIKTVVRLDTITFLITLLISGFIFNMVLNLPYTSPVGYLFGAITAATDPATLIPVFSRVRTNPEVAITLEAESIFNDPLGIVSTSVILGLFGLFSSSNPLIDLITLAGGAIVVGLLLAKIYEKIIIHCDFHEYVAPLVLGGAMLLLYVGDDLLPSICGYGFSGYMAVAIMGLYLGDALFRADDIDYKYIVSFCDDLSLLARVFIFVFLGACIKLSMLENYFIPGLLVALGSIFLARPLGVFLGLIGSKHSFKEKLYFALEGPRGVVPAALAVTVGIEILKNADKIPASITKYITPTDIAGTIIIGTFMTILLSVILEASWAGMLALKLLGEYKPK 419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4D0A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4D0A)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4D0A)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)
Chain B   (NAH1_METJA | Q60362)
molecular function
    GO:0015297    antiporter activity    Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported in opposite directions in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy. The reaction is: solute A(out) + solute B(in) = solute A(in) + solute B(out).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0015299    solute:proton antiporter activity    Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: solute(out) + H+(in) = solute(in) + H+(out).
biological process
    GO:0006812    cation transport    The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1902600    hydrogen ion transmembrane transport    The directed movement of hydrogen ion (proton) across a membrane.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006814    sodium ion transport    The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4d0a)
 
  Sites
(no "Sites" information available for 4d0a)
 
  Cis Peptide Bonds
    Ile B:377 - Thr B:378   [ RasMol ]  
    Thr B:145 - Asn B:146   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4d0a
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NAH1_METJA | Q60362
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NAH1_METJA | Q60362
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NAH1_METJA | Q60362: 4czb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4D0A)