Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TRUNCATED TETRAMERIZATION DOMAIN OF ZEBRAFISH P53 (CRYSTAL FORM I)
 
Authors :  A. C. Joerger
Date :  16 Apr 14  (Deposition) - 27 Aug 14  (Release) - 17 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.02
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Cell Cycle, P53 Family, Tumor Suppressor, Transcription Factor, Protein Evolution (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. C. Joerger, R. Wilcken, C. M. Johnson, A. Andreeva
Tracing The Evolution Of The P53 Tetramerization Domain
Structure V. 22 1301 2014
PubMed-ID: 25185827  |  Reference-DOI: 10.1016/J.STR.2014.07.010

(-) Compounds

Molecule 1 - CELLULAR TUMOR ANTIGEN P53
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentTRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 302-311
    Organism CommonZEBRAFISH
    Organism ScientificDANIO RERIO
    Organism Taxid7955
    SynonymP53

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4CZ5)

(-) Sites  (0, 0)

(no "Site" information available for 4CZ5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CZ5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4CZ5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4CZ5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4CZ5)

(-) Exons   (0, 0)

(no "Exon" information available for 4CZ5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:29
 aligned with G1K2L5_DANRE | G1K2L5 from UniProtKB/TrEMBL  Length:374

    Alignment length:29
                                   312       322         
         G1K2L5_DANRE   303 EIFTLQVRGRERYEILKKLNDSLELSDVV 331
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 4cz5 A 303 EIFTLQVRGRERYEILKKLNDSLELSDVV 331
                                   312       322         

Chain B from PDB  Type:PROTEIN  Length:28
 aligned with G1K2L5_DANRE | G1K2L5 from UniProtKB/TrEMBL  Length:374

    Alignment length:28
                                   312       322        
         G1K2L5_DANRE   303 EIFTLQVRGRERYEILKKLNDSLELSDV 330
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                 4cz5 B 303 EIFTLQVRGRERYEILKKLNDSLELSDV 330
                                   312       322        

Chain C from PDB  Type:PROTEIN  Length:32
 aligned with G1K2L5_DANRE | G1K2L5 from UniProtKB/TrEMBL  Length:374

    Alignment length:35
                                   306       316       326     
         G1K2L5_DANRE   297 GSSSDEEIFTLQVRGRERYEILKKLNDSLELSDVV 331
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ..---..eeeeeeehhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 4cz5 C 300 GS---EEIFTLQVRGRERYEILKKLNDSLELSDVV 331
                             |   | 306       316       326     
                           301 302                             

Chain D from PDB  Type:PROTEIN  Length:29
 aligned with G1K2L5_DANRE | G1K2L5 from UniProtKB/TrEMBL  Length:374

    Alignment length:29
                                   312       322         
         G1K2L5_DANRE   303 EIFTLQVRGRERYEILKKLNDSLELSDVV 331
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 4cz5 D 303 EIFTLQVRGRERYEILKKLNDSLELSDVV 331
                                   312       322         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CZ5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CZ5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CZ5)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (G1K2L5_DANRE | G1K2L5)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4cz5)
 
  Sites
(no "Sites" information available for 4cz5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4cz5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cz5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G1K2L5_DANRE | G1K2L5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  G1K2L5_DANRE | G1K2L5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G1K2L5_DANRE | G1K2L54cz7 4d1l 4d1m

(-) Related Entries Specified in the PDB File

4cz6 TRUNCATED TETRAMERIZATION DOMAIN OF ZEBRAFISH P53 (CRYSTAL FORM II)
4cz7 TRUNCATED TETRAMERIZATION DOMAIN OF ZEBRAFISH P53 (CRYSTAL FORM III)