4CKT - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   PIH1 N-TERMINAL DOMAIN

Authors :   R. M. Morgan, S. M. Roe

Date :   08 Jan 14 (Deposition) - 14 May 14 (Release) - 25 Jun 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: B,D  (1x)
Biol. Unit 2: A,C  (1x)

Keywords :   Chaperone-Peptide Complex, Chaperone, Multiprotein Complexes, Phosphorylation, R2Tp (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Pal, M. Morgan, S. E. Phelps, S. M. Roe, S. Parry-Morris, J. A. Downs, S. Polier, L. H. Pearl, C. Prodromou
Structural Basis For Phosphorylation-Dependent Recruitment Of Tel2 To Hsp90 By Pih1.
Structure V. 22 805 2014
PubMed-ID: 24794838 | Reference-DOI: 10.1016/J.STR.2014.04.001

Molecule 1 - PIH1 DOMAIN-CONTAINING PROTEIN 1
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	RESIDUES 1-200
	Organism Common	:	MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	NUCLEOLAR PROTEIN 17 HOMOLOG, PIH1D1

Molecule 2 - TELOMERE LENGTH REGULATION PROTEIN TEL2 HOMOLOG
	Chains	:	C, D
	Fragment	:	RESIDUES 489-496
	Organism Common	:	MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:		B		D
Biological Unit 2 (1x)	:	A		C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	MSE	8	Mod. Amino Acid	SELENOMETHIONINE
2	SEP	2	Mod. Amino Acid	PHOSPHOSERINE

Biological Unit 1 (2, 5)

No.	Name	Count	Type	Full Name
1	MSE	4	Mod. Amino Acid	SELENOMETHIONINE
2	SEP	1	Mod. Amino Acid	PHOSPHOSERINE

Biological Unit 2 (2, 5)

No.	Name	Count	Type	Full Name
1	MSE	4	Mod. Amino Acid	SELENOMETHIONINE
2	SEP	1	Mod. Amino Acid	PHOSPHOSERINE

(no "Site" information available for 4CKT)

(no "SS Bond" information available for 4CKT)

Asymmetric Unit

No.	Residues
1	Ala A:79	-	Asp A:80
2	Asp A:84	-	Glu A:85
3	Ile B:75	-	Pro B:76
4	Ala B:79	-	Asp B:80
5	Gln B:94	-	Ala B:95
6	Ala B:95	-	Gly B:96
7	Gly B:96	-	Phe B:97
8	Gly B:155	-	Leu B:156
9	Ser B:173	-	Ile B:174
10	Ser B:175	-	Gln B:176
11	Gln B:176	-	Gln B:177

(no "SAP(SNP)/Variant" information available for 4CKT)

(no "PROSITE Motif" information available for 4CKT)

(no "Exon" information available for 4CKT)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:127
 aligned with PIHD1_MOUSE | Q9CQJ2 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:127
                                    56        66        76        86        96       106       116       126       136       146       156       166       
          PIHD1_MOUSE    47 QIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGS 173
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee....eeeeeeeee.........hhhhhhhhhhh.........eeeeeeeee.....eeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ckt A  47 QIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQmLEEDQAGFRIPmSLGEPHAELDAKGQGCTAYDVAVNSNFYLRmQNSDFLRELVVTIAREGLEDKYGLQLNPEWRmLKYRSFLGS 173
                                    56        66        76        86  |     96    |  106       116       126     | 136       146       156       166       
                                                                     89-MSE     101-MSE                        132-MSE                         164-MSE

Chain B from PDB  Type:PROTEIN  Length:132
 aligned with PIHD1_MOUSE | Q9CQJ2 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:132
                                    57        67        77        87        97       107       117       127       137       147       157       167       177  
          PIHD1_MOUSE    48 IQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNI 179
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeeee....eeeeeeeee.........hhhhhhhhh...........ee...eeee.....eeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4ckt B  48 IQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQmLEEDQAGFRIPmSLGEPHAELDAKGQGCTAYDVAVNSNFYLRmQNSDFLRELVVTIAREGLEDKYGLQLNPEWRmLKYRSFLGSISQQNI 179
                                    57        67        77        87 |      97   |   107       117       127    |  137       147       157      |167       177  
                                                                    89-MSE     101-MSE                        132-MSE                         164-MSE

Chain C from PDB  Type:PROTEIN  Length:8
 aligned with TELO2_MOUSE | Q9DC40 from UniProtKB/Swiss-Prot  Length:840

    Alignment length:8
          TELO2_MOUSE   489 ELDSDDEF 496
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 4ckt C   6 ELDsDDEF  13
                               |    
                               9-SEP

Chain D from PDB  Type:PROTEIN  Length:8
 aligned with TELO2_MOUSE | Q9DC40 from UniProtKB/Swiss-Prot  Length:840

    Alignment length:14
                                   498    
          TELO2_MOUSE   489 ELDSDDEFIPYDMS 502
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author .......------. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
                 Transcript -------------- Transcript
                 4ckt D   6 ELDsDDE------S  96
                               |  |  -   |
                               9-SEP    96

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4CKT)

(no "CATH Domain" information available for 4CKT)

(no "Pfam Domain" information available for 4CKT)

Asymmetric Unit(hide GO term definitions)

Chain A,B (PIHD1_MOUSE | Q9CQJ2)

molecular function
	GO:0051117	ATPase binding	Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
	GO:0001164	RNA polymerase I CORE element sequence-specific DNA binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for transcription factors of the RNA polymerase I transcription machinery. This site is often referred to as the CORE element. In mammalian cells, the CORE element functions in conjunction with the Upstream Control Element (UCE), while in fungi, protozoa, and plants, the CORE element functions without a UCE.
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0051219	phosphoprotein binding	Interacting selectively and non-covalently with a phosphorylated protein.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0000492	box C/D snoRNP assembly	The aggregation, arrangement and bonding together of proteins and a box C/D snoRNA to form a box C/D small nucleolar ribonucleoprotein (snoRNP) complex.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0071169	establishment of protein localization to chromatin	The directed movement of a protein to a part of a chromosome that is organized into chromatin.
	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:1900110	negative regulation of histone H3-K9 dimethylation	Any process that stops, prevents or reduces the frequency, rate or extent of histone H3-K9 dimethylation.
	GO:1900113	negative regulation of histone H3-K9 trimethylation	Any process that stops, prevents or reduces the frequency, rate or extent of histone H3-K9 trimethylation.
	GO:2000619	negative regulation of histone H4-K16 acetylation	Any process that stops, prevents or reduces the frequency, rate or extent of histone H4-K16 acetylation.
	GO:1904263	positive regulation of TORC1 signaling	Any process that activates or increases the frequency, rate or extent of TORC1 signaling.
	GO:1902661	positive regulation of glucose mediated signaling pathway	Any process that activates or increases the frequency, rate or extent of glucose mediated signaling pathway.
	GO:2000617	positive regulation of histone H3-K9 acetylation	Any process that activates or increases the frequency, rate or extent of histone H3-K9 acetylation.
	GO:0090240	positive regulation of histone H4 acetylation	Any process that increases the rate, frequency, or extent of histone H4 acetylation, the modification of histone H4 by the addition of an acetyl group.
	GO:0031334	positive regulation of protein complex assembly	Any process that activates or increases the frequency, rate or extent of protein complex assembly.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:1901838	positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter	Any process that activates or increases the frequency, rate or extent of transcription of nuclear large rRNA transcript from RNA polymerase I promoter.
	GO:0051569	regulation of histone H3-K4 methylation	Any process that modulates the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0048254	snoRNA localization	Any process in which small nucleolar RNA is transported to, or maintained in, a specific location.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0097255	R2TP complex	A highly conserved protein complex comprised of two ATP-dependent DNA helicases (Rvb1p and Rvb2p in yeast, Pontin52 and Reptin52 in humans), Pih1p in yeast or PIH1D1 in humans, and Tah1 in yeast or RPAP3 in humans. The complex associates with Hsp90 and is thought to have a role in assembly of large protein or protein/nucleic acid complexes. In this role it is involved in multiple processes such as box C/D snoRNP biogenesis, phosphatidylinositol-3 kinase-related protein kinase (PIKK) signaling, RNA polymerase II assembly, and others.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0070761	pre-snoRNP complex	A ribonucleoprotein complex that contains a precursor small nucleolar RNA (pre-snoRNA) and associated proteins, and forms during small nucleolar ribonucleoprotein complex (snoRNP) assembly. Pre-snoRNP complexes may contain proteins not found in the corresponding mature snoRNP complexes.

Chain C,D (TELO2_MOUSE | Q9DC40)

molecular function
	GO:0051879	Hsp90 protein binding	Interacting selectively and non-covalently with Hsp90 proteins, any of a group of heat shock proteins around 90kDa in size.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032947	protein complex scaffold activity	A structural molecule activity that provides a physical support for the assembly of a multiprotein complex. The scaffold may or may not be part of the final complex.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:1904263	positive regulation of TORC1 signaling	Any process that activates or increases the frequency, rate or extent of TORC1 signaling.
	GO:1904515	positive regulation of TORC2 signaling	Any process that activates or increases the frequency, rate or extent of TORC2 signaling.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
	GO:0032006	regulation of TOR signaling	Any process that modulates the frequency, rate or extent of TOR signaling.
cellular component
	GO:0031931	TORC1 complex	A protein complex that contains at least TOR (target of rapamycin) and Raptor (regulatory-associated protein of TOR), or orthologs of, in complex with other signaling components. Mediates the phosphorylation and activation of S6K. In Saccharomyces, the complex contains Kog1p, Lst8p, Tco89p, and either Tor1p or Tor2p.
	GO:0031932	TORC2 complex	A protein complex that contains at least TOR (target of rapamycin) and Rictor (rapamycin-insensitive companion of TOR), or orthologs of, in complex with other signaling components. Mediates the phosphorylation and activation of PKB (also called AKT). In Saccharomyces, the complex contains Avo1p, Avo2p, Tsc11p, Lst8p, Bit61p, Slm1p, Slm2p, and Tor2p.
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0034399	nuclear periphery	The portion of the nuclear lumen proximal to the inner nuclear membrane.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SEP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 4ckt)

	Cis Peptide Bonds
		Ala A:79 - Asp A:80	[ RasMol ]
		Ala B:79 - Asp B:80	[ RasMol ]
		Ala B:95 - Gly B:96	[ RasMol ]
		Asp A:84 - Glu A:85	[ RasMol ]
		Gln B:176 - Gln B:177	[ RasMol ]
		Gln B:94 - Ala B:95	[ RasMol ]
		Gly B:155 - Leu B:156	[ RasMol ]
		Gly B:96 - Phe B:97	[ RasMol ]
		Ile B:75 - Pro B:76	[ RasMol ]
		Ser B:173 - Ile B:174	[ RasMol ]
		Ser B:175 - Gln B:176	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4ckt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PIHD1_MOUSE \| Q9CQJ2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TELO2_MOUSE \| Q9DC40
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PIHD1_MOUSE \| Q9CQJ2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TELO2_MOUSE \| Q9DC40
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PIHD1_MOUSE \| Q9CQJ2	:	4cse 4cv4
	TELO2_MOUSE \| Q9DC40	:	4cse

(no "Related Entries Specified in the PDB File" available for 4CKT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (11, 11)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (43, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File